SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126457176|ref|YP_001077187.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126457176|ref|YP_001077187.1|
Domain Number 1 Region: 9-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.24e-74
Family Phosphate binding protein-like 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126457176|ref|YP_001077187.1|
Sequence length 250
Comment glutamine ABC transporter periplasmic protein [Burkholderia pseudomallei 1106a]
Sequence
MGRRSFIKTIVALALVGASAAGAHAKELVVGTDTSFMPFEFKQGDKYVGFDLDLWAEIAK
GAGWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQAN
NTTIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKEIRQFPNIDQAYLALEAGRVDAAMHD
TPNVLFFVNNEGKGRVKVAGAPVSGDKYGIGFPKGSPLVAKVNAELARMKADGRYAKIYK
KWFGSEPPKS
Download sequence
Identical sequences A0A069BJ47 A0A0E1S856 A0A0E1UCQ4 A0A0E1W8W1 A0A0F6L3Y1 A0A0H3HXU1 A3PA27 A8EAV4 B1H4C7 Q3JIF9 Q63HT3
gi|126457176|ref|YP_001077187.1| gi|403524381|ref|YP_006659950.1| gi|386866177|ref|YP_006279125.1| 272560.BPSS2337 320372.BURPS1710b_A1487 357348.BURPS1106A_A3158 gi|53723354|ref|YP_112339.1| gi|526458683|ref|YP_008329579.1| WP_004523230.1.100195 WP_004523230.1.10047 WP_004523230.1.100583 WP_004523230.1.100720 WP_004523230.1.100825 WP_004523230.1.100900 WP_004523230.1.1010 WP_004523230.1.101060 WP_004523230.1.101307 WP_004523230.1.101381 WP_004523230.1.101559 WP_004523230.1.101588 WP_004523230.1.102051 WP_004523230.1.10269 WP_004523230.1.10290 WP_004523230.1.10359 WP_004523230.1.10907 WP_004523230.1.11046 WP_004523230.1.11747 WP_004523230.1.11825 WP_004523230.1.11893 WP_004523230.1.11996 WP_004523230.1.11998 WP_004523230.1.1266 WP_004523230.1.12731 WP_004523230.1.12793 WP_004523230.1.12856 WP_004523230.1.12860 WP_004523230.1.13198 WP_004523230.1.13309 WP_004523230.1.13504 WP_004523230.1.13520 WP_004523230.1.13597 WP_004523230.1.13603 WP_004523230.1.13639 WP_004523230.1.14356 WP_004523230.1.14539 WP_004523230.1.14557 WP_004523230.1.14660 WP_004523230.1.15170 WP_004523230.1.15364 WP_004523230.1.15525 WP_004523230.1.15673 WP_004523230.1.16249 WP_004523230.1.16540 WP_004523230.1.16625 WP_004523230.1.16680 WP_004523230.1.16689 WP_004523230.1.16749 WP_004523230.1.17068 WP_004523230.1.17278 WP_004523230.1.17473 WP_004523230.1.17748 WP_004523230.1.17786 WP_004523230.1.18396 WP_004523230.1.18405 WP_004523230.1.18471 WP_004523230.1.18549 WP_004523230.1.18669 WP_004523230.1.18704 WP_004523230.1.18744 WP_004523230.1.18906 WP_004523230.1.19401 WP_004523230.1.19540 WP_004523230.1.19629 WP_004523230.1.1976 WP_004523230.1.20021 WP_004523230.1.20246 WP_004523230.1.20520 WP_004523230.1.20954 WP_004523230.1.21147 WP_004523230.1.21205 WP_004523230.1.21304 WP_004523230.1.21461 WP_004523230.1.21809 WP_004523230.1.21907 WP_004523230.1.22046 WP_004523230.1.22308 WP_004523230.1.22779 WP_004523230.1.23131 WP_004523230.1.2317 WP_004523230.1.23743 WP_004523230.1.23852 WP_004523230.1.23994 WP_004523230.1.24314 WP_004523230.1.24372 WP_004523230.1.24701 WP_004523230.1.25068 WP_004523230.1.25102 WP_004523230.1.25138 WP_004523230.1.25265 WP_004523230.1.25412 WP_004523230.1.25628 WP_004523230.1.25728 WP_004523230.1.259 WP_004523230.1.26054 WP_004523230.1.26502 WP_004523230.1.267 WP_004523230.1.26838 WP_004523230.1.26849 WP_004523230.1.27064 WP_004523230.1.27069 WP_004523230.1.27363 WP_004523230.1.27390 WP_004523230.1.27399 WP_004523230.1.27420 WP_004523230.1.27597 WP_004523230.1.27909 WP_004523230.1.28018 WP_004523230.1.28187 WP_004523230.1.28594 WP_004523230.1.28619 WP_004523230.1.28632 WP_004523230.1.29161 WP_004523230.1.29178 WP_004523230.1.29335 WP_004523230.1.29405 WP_004523230.1.29508 WP_004523230.1.29520 WP_004523230.1.29547 WP_004523230.1.29658 WP_004523230.1.29853 WP_004523230.1.29887 WP_004523230.1.29899 WP_004523230.1.29948 WP_004523230.1.30311 WP_004523230.1.30382 WP_004523230.1.3041 WP_004523230.1.30671 WP_004523230.1.3069 WP_004523230.1.30937 WP_004523230.1.32174 WP_004523230.1.32182 WP_004523230.1.32221 WP_004523230.1.324 WP_004523230.1.3273 WP_004523230.1.32951 WP_004523230.1.33077 WP_004523230.1.33087 WP_004523230.1.33157 WP_004523230.1.33165 WP_004523230.1.332 WP_004523230.1.33366 WP_004523230.1.33493 WP_004523230.1.33573 WP_004523230.1.33779 WP_004523230.1.34230 WP_004523230.1.34393 WP_004523230.1.34564 WP_004523230.1.35025 WP_004523230.1.35090 WP_004523230.1.35141 WP_004523230.1.35227 WP_004523230.1.35249 WP_004523230.1.35474 WP_004523230.1.35485 WP_004523230.1.35491 WP_004523230.1.36106 WP_004523230.1.36174 WP_004523230.1.36259 WP_004523230.1.36666 WP_004523230.1.36944 WP_004523230.1.3706 WP_004523230.1.37373 WP_004523230.1.37428 WP_004523230.1.37446 WP_004523230.1.37519 WP_004523230.1.37581 WP_004523230.1.37622 WP_004523230.1.37627 WP_004523230.1.37690 WP_004523230.1.37725 WP_004523230.1.37806 WP_004523230.1.37934 WP_004523230.1.38115 WP_004523230.1.38442 WP_004523230.1.38490 WP_004523230.1.38683 WP_004523230.1.3872 WP_004523230.1.38810 WP_004523230.1.39078 WP_004523230.1.39162 WP_004523230.1.39179 WP_004523230.1.39595 WP_004523230.1.39757 WP_004523230.1.39898 WP_004523230.1.40021 WP_004523230.1.40045 WP_004523230.1.40235 WP_004523230.1.40275 WP_004523230.1.40388 WP_004523230.1.40426 WP_004523230.1.41945 WP_004523230.1.42408 WP_004523230.1.42492 WP_004523230.1.42496 WP_004523230.1.43136 WP_004523230.1.43156 WP_004523230.1.43373 WP_004523230.1.43581 WP_004523230.1.43587 WP_004523230.1.43678 WP_004523230.1.43727 WP_004523230.1.43786 WP_004523230.1.44234 WP_004523230.1.44414 WP_004523230.1.44824 WP_004523230.1.45284 WP_004523230.1.45537 WP_004523230.1.45715 WP_004523230.1.45890 WP_004523230.1.4631 WP_004523230.1.46757 WP_004523230.1.46829 WP_004523230.1.46969 WP_004523230.1.47086 WP_004523230.1.47149 WP_004523230.1.48093 WP_004523230.1.48165 WP_004523230.1.48464 WP_004523230.1.49717 WP_004523230.1.49872 WP_004523230.1.50174 WP_004523230.1.50401 WP_004523230.1.50788 WP_004523230.1.50839 WP_004523230.1.51606 WP_004523230.1.5173 WP_004523230.1.5182 WP_004523230.1.52229 WP_004523230.1.52407 WP_004523230.1.52451 WP_004523230.1.52521 WP_004523230.1.52547 WP_004523230.1.52643 WP_004523230.1.52731 WP_004523230.1.52760 WP_004523230.1.5292 WP_004523230.1.53034 WP_004523230.1.53048 WP_004523230.1.53132 WP_004523230.1.53282 WP_004523230.1.5338 WP_004523230.1.54016 WP_004523230.1.5413 WP_004523230.1.54312 WP_004523230.1.54369 WP_004523230.1.54804 WP_004523230.1.54859 WP_004523230.1.55038 WP_004523230.1.55415 WP_004523230.1.55691 WP_004523230.1.55755 WP_004523230.1.5608 WP_004523230.1.56126 WP_004523230.1.56248 WP_004523230.1.5641 WP_004523230.1.56451 WP_004523230.1.56458 WP_004523230.1.56744 WP_004523230.1.57046 WP_004523230.1.57096 WP_004523230.1.57247 WP_004523230.1.5734 WP_004523230.1.57341 WP_004523230.1.57359 WP_004523230.1.5776 WP_004523230.1.58003 WP_004523230.1.58105 WP_004523230.1.58355 WP_004523230.1.58405 WP_004523230.1.58509 WP_004523230.1.58523 WP_004523230.1.58578 WP_004523230.1.58758 WP_004523230.1.5883 WP_004523230.1.59103 WP_004523230.1.59200 WP_004523230.1.59422 WP_004523230.1.59519 WP_004523230.1.59747 WP_004523230.1.60769 WP_004523230.1.60810 WP_004523230.1.60969 WP_004523230.1.61084 WP_004523230.1.61202 WP_004523230.1.61685 WP_004523230.1.61723 WP_004523230.1.61854 WP_004523230.1.6186 WP_004523230.1.61900 WP_004523230.1.62103 WP_004523230.1.62774 WP_004523230.1.63097 WP_004523230.1.63361 WP_004523230.1.63439 WP_004523230.1.63661 WP_004523230.1.63719 WP_004523230.1.63942 WP_004523230.1.64068 WP_004523230.1.64096 WP_004523230.1.64364 WP_004523230.1.64383 WP_004523230.1.64683 WP_004523230.1.64892 WP_004523230.1.65468 WP_004523230.1.65832 WP_004523230.1.65994 WP_004523230.1.66257 WP_004523230.1.66321 WP_004523230.1.66380 WP_004523230.1.67117 WP_004523230.1.67182 WP_004523230.1.67559 WP_004523230.1.6765 WP_004523230.1.67860 WP_004523230.1.67914 WP_004523230.1.67978 WP_004523230.1.6835 WP_004523230.1.68886 WP_004523230.1.68922 WP_004523230.1.69022 WP_004523230.1.69217 WP_004523230.1.69354 WP_004523230.1.69770 WP_004523230.1.70016 WP_004523230.1.7006 WP_004523230.1.70066 WP_004523230.1.70096 WP_004523230.1.70278 WP_004523230.1.70280 WP_004523230.1.70735 WP_004523230.1.71392 WP_004523230.1.71444 WP_004523230.1.71564 WP_004523230.1.71901 WP_004523230.1.72015 WP_004523230.1.72083 WP_004523230.1.72817 WP_004523230.1.73317 WP_004523230.1.73418 WP_004523230.1.73521 WP_004523230.1.73576 WP_004523230.1.73906 WP_004523230.1.73974 WP_004523230.1.74177 WP_004523230.1.74425 WP_004523230.1.74569 WP_004523230.1.74690 WP_004523230.1.75027 WP_004523230.1.75075 WP_004523230.1.75677 WP_004523230.1.75711 WP_004523230.1.75776 WP_004523230.1.75883 WP_004523230.1.75913 WP_004523230.1.75937 WP_004523230.1.76142 WP_004523230.1.76290 WP_004523230.1.76522 WP_004523230.1.76575 WP_004523230.1.766 WP_004523230.1.7703 WP_004523230.1.77249 WP_004523230.1.77319 WP_004523230.1.77689 WP_004523230.1.77788 WP_004523230.1.78029 WP_004523230.1.78278 WP_004523230.1.78506 WP_004523230.1.78628 WP_004523230.1.78807 WP_004523230.1.78827 WP_004523230.1.79052 WP_004523230.1.79360 WP_004523230.1.79710 WP_004523230.1.79725 WP_004523230.1.79782 WP_004523230.1.80098 WP_004523230.1.80302 WP_004523230.1.80395 WP_004523230.1.80433 WP_004523230.1.80614 WP_004523230.1.80923 WP_004523230.1.81042 WP_004523230.1.8126 WP_004523230.1.81479 WP_004523230.1.81511 WP_004523230.1.81543 WP_004523230.1.82394 WP_004523230.1.82506 WP_004523230.1.82575 WP_004523230.1.82694 WP_004523230.1.82727 WP_004523230.1.82950 WP_004523230.1.83080 WP_004523230.1.83357 WP_004523230.1.8341 WP_004523230.1.83487 WP_004523230.1.83543 WP_004523230.1.83609 WP_004523230.1.83688 WP_004523230.1.8388 WP_004523230.1.8390 WP_004523230.1.8395 WP_004523230.1.83967 WP_004523230.1.84002 WP_004523230.1.84026 WP_004523230.1.84181 WP_004523230.1.84375 WP_004523230.1.84379 WP_004523230.1.84654 WP_004523230.1.84866 WP_004523230.1.85412 WP_004523230.1.85467 WP_004523230.1.85565 WP_004523230.1.85584 WP_004523230.1.856 WP_004523230.1.85641 WP_004523230.1.85645 WP_004523230.1.85774 WP_004523230.1.8585 WP_004523230.1.8629 WP_004523230.1.86295 WP_004523230.1.86438 WP_004523230.1.86525 WP_004523230.1.86806 WP_004523230.1.86872 WP_004523230.1.87114 WP_004523230.1.87278 WP_004523230.1.87324 WP_004523230.1.87652 WP_004523230.1.87759 WP_004523230.1.87811 WP_004523230.1.88003 WP_004523230.1.88117 WP_004523230.1.88168 WP_004523230.1.88237 WP_004523230.1.88369 WP_004523230.1.88411 WP_004523230.1.88666 WP_004523230.1.88682 WP_004523230.1.88764 WP_004523230.1.89093 WP_004523230.1.89240 WP_004523230.1.89435 WP_004523230.1.89514 WP_004523230.1.89782 WP_004523230.1.90471 WP_004523230.1.91025 WP_004523230.1.91142 WP_004523230.1.91700 WP_004523230.1.91709 WP_004523230.1.91763 WP_004523230.1.92367 WP_004523230.1.92406 WP_004523230.1.92430 WP_004523230.1.92493 WP_004523230.1.9280 WP_004523230.1.92904 WP_004523230.1.93845 WP_004523230.1.94117 WP_004523230.1.94121 WP_004523230.1.94286 WP_004523230.1.94498 WP_004523230.1.94520 WP_004523230.1.94901 WP_004523230.1.95054 WP_004523230.1.95300 WP_004523230.1.9537 WP_004523230.1.95587 WP_004523230.1.95644 WP_004523230.1.95672 WP_004523230.1.95938 WP_004523230.1.96381 WP_004523230.1.97058 WP_004523230.1.97112 WP_004523230.1.97148 WP_004523230.1.97989 WP_004523230.1.98316 WP_004523230.1.98491 WP_004523230.1.98547 WP_004523230.1.98688 WP_004523230.1.98713 WP_004523230.1.98753 WP_004523230.1.98768 WP_004523230.1.98944 WP_004523230.1.99069 WP_004523230.1.99160 WP_004523230.1.9962 WP_004523230.1.99629 WP_004523230.1.9975 WP_004523230.1.9983 WP_004523230.1.99890 WP_004523230.1.99919 YP_112339.1.59693 gi|76818697|ref|YP_336644.1| gi|556571952|ref|YP_008741575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]