SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126457537|ref|YP_001076168.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126457537|ref|YP_001076168.1|
Domain Number 1 Region: 28-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.13e-45
Family Phosphate binding protein-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126457537|ref|YP_001076168.1|
Sequence length 336
Comment taurine ABC transporter periplasmic taurine-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MILKRILIAASFTAAAASAVHSHAARAETVNVAYQYGADPAKLAQAGAAYEKATGWKINW
RRFDSGADVVAALASGDVQLGDVGQSPFTAAVSRGVPIQAVALNAITGVSEALVVRRGAH
IDKPADLVGKTIATPYASNCHYALLAALKHWGIDAQRVKIVNLGPTEIVAAWARGVIDAA
YTWDPALGRAKASGGKVLVDSAEVGKWGAPTFDLWAVRSDFAQAHPDFVSKFVKVTTQAI
ADYRANGKAWTSASRQVAEISRLSGAAAGDIAQLLAGNLYPSAAEQASPELLGGGTADAI
ASTARFLKEQRKIDRVLPDYRPTVTDRFVRAAIAAR
Download sequence
Identical sequences A0A069BGM4 A0A0E1S5R2 A0A0E1TMH1 A0A0E1ULK8 A0A0E1W0F7 A0A0F6G870 A0A0F6L1J6 A0A0H3HYG9 A0A2K3GF35 A3P758 B1H9T7 Q3JKX2 Q63JZ2
gi|126457537|ref|YP_001076168.1| 272560.BPSS1574 320372.BURPS1710b_A0622 357348.BURPS1106A_A2135 gi|386865363|ref|YP_006278311.1| gi|76818635|ref|YP_335781.1| gi|53722595|ref|YP_111580.1| WP_004525289.1.100195 WP_004525289.1.10047 WP_004525289.1.100583 WP_004525289.1.100720 WP_004525289.1.100825 WP_004525289.1.100900 WP_004525289.1.1010 WP_004525289.1.101060 WP_004525289.1.101307 WP_004525289.1.101381 WP_004525289.1.101559 WP_004525289.1.101588 WP_004525289.1.10269 WP_004525289.1.10290 WP_004525289.1.10359 WP_004525289.1.10553 WP_004525289.1.10633 WP_004525289.1.10746 WP_004525289.1.10907 WP_004525289.1.11046 WP_004525289.1.11072 WP_004525289.1.11160 WP_004525289.1.11268 WP_004525289.1.11404 WP_004525289.1.11825 WP_004525289.1.11893 WP_004525289.1.11998 WP_004525289.1.1266 WP_004525289.1.12731 WP_004525289.1.12793 WP_004525289.1.12856 WP_004525289.1.12860 WP_004525289.1.13198 WP_004525289.1.13520 WP_004525289.1.13597 WP_004525289.1.13639 WP_004525289.1.13950 WP_004525289.1.14356 WP_004525289.1.14539 WP_004525289.1.1465 WP_004525289.1.14660 WP_004525289.1.15170 WP_004525289.1.15364 WP_004525289.1.15525 WP_004525289.1.15673 WP_004525289.1.15696 WP_004525289.1.16113 WP_004525289.1.16249 WP_004525289.1.16358 WP_004525289.1.16540 WP_004525289.1.16561 WP_004525289.1.16680 WP_004525289.1.16689 WP_004525289.1.16749 WP_004525289.1.17068 WP_004525289.1.17278 WP_004525289.1.17786 WP_004525289.1.18058 WP_004525289.1.18396 WP_004525289.1.18405 WP_004525289.1.18669 WP_004525289.1.18704 WP_004525289.1.18744 WP_004525289.1.18906 WP_004525289.1.19401 WP_004525289.1.19486 WP_004525289.1.19629 WP_004525289.1.19815 WP_004525289.1.19842 WP_004525289.1.20021 WP_004525289.1.20246 WP_004525289.1.20501 WP_004525289.1.20520 WP_004525289.1.20954 WP_004525289.1.21147 WP_004525289.1.21205 WP_004525289.1.21291 WP_004525289.1.21304 WP_004525289.1.21409 WP_004525289.1.21461 WP_004525289.1.21653 WP_004525289.1.21809 WP_004525289.1.21907 WP_004525289.1.22046 WP_004525289.1.2261 WP_004525289.1.22779 WP_004525289.1.23086 WP_004525289.1.23104 WP_004525289.1.23131 WP_004525289.1.23743 WP_004525289.1.23852 WP_004525289.1.23994 WP_004525289.1.24020 WP_004525289.1.2404 WP_004525289.1.24314 WP_004525289.1.24372 WP_004525289.1.24454 WP_004525289.1.24513 WP_004525289.1.24701 WP_004525289.1.25068 WP_004525289.1.25102 WP_004525289.1.25138 WP_004525289.1.25265 WP_004525289.1.25628 WP_004525289.1.259 WP_004525289.1.26054 WP_004525289.1.26502 WP_004525289.1.26535 WP_004525289.1.26565 WP_004525289.1.26645 WP_004525289.1.267 WP_004525289.1.26838 WP_004525289.1.26849 WP_004525289.1.27064 WP_004525289.1.27069 WP_004525289.1.27146 WP_004525289.1.27363 WP_004525289.1.27390 WP_004525289.1.27399 WP_004525289.1.27420 WP_004525289.1.27441 WP_004525289.1.27597 WP_004525289.1.27810 WP_004525289.1.27909 WP_004525289.1.28018 WP_004525289.1.28187 WP_004525289.1.28594 WP_004525289.1.28619 WP_004525289.1.28632 WP_004525289.1.29178 WP_004525289.1.29335 WP_004525289.1.29405 WP_004525289.1.29508 WP_004525289.1.29520 WP_004525289.1.29547 WP_004525289.1.29658 WP_004525289.1.29887 WP_004525289.1.29899 WP_004525289.1.30311 WP_004525289.1.30671 WP_004525289.1.3069 WP_004525289.1.30729 WP_004525289.1.30937 WP_004525289.1.31723 WP_004525289.1.32174 WP_004525289.1.32182 WP_004525289.1.32221 WP_004525289.1.32581 WP_004525289.1.3273 WP_004525289.1.32951 WP_004525289.1.33077 WP_004525289.1.33087 WP_004525289.1.33130 WP_004525289.1.33157 WP_004525289.1.33158 WP_004525289.1.33165 WP_004525289.1.332 WP_004525289.1.33366 WP_004525289.1.33573 WP_004525289.1.33779 WP_004525289.1.34333 WP_004525289.1.34393 WP_004525289.1.34564 WP_004525289.1.35052 WP_004525289.1.35090 WP_004525289.1.35141 WP_004525289.1.35227 WP_004525289.1.35249 WP_004525289.1.35474 WP_004525289.1.35485 WP_004525289.1.35491 WP_004525289.1.35825 WP_004525289.1.36106 WP_004525289.1.36174 WP_004525289.1.36259 WP_004525289.1.36527 WP_004525289.1.366 WP_004525289.1.36662 WP_004525289.1.36666 WP_004525289.1.36944 WP_004525289.1.3706 WP_004525289.1.37373 WP_004525289.1.37428 WP_004525289.1.37517 WP_004525289.1.37519 WP_004525289.1.37535 WP_004525289.1.37581 WP_004525289.1.37622 WP_004525289.1.37627 WP_004525289.1.37690 WP_004525289.1.37702 WP_004525289.1.37725 WP_004525289.1.37806 WP_004525289.1.37934 WP_004525289.1.37959 WP_004525289.1.37994 WP_004525289.1.38115 WP_004525289.1.38442 WP_004525289.1.38490 WP_004525289.1.3872 WP_004525289.1.38810 WP_004525289.1.39078 WP_004525289.1.39162 WP_004525289.1.39179 WP_004525289.1.39595 WP_004525289.1.39757 WP_004525289.1.40045 WP_004525289.1.40235 WP_004525289.1.40275 WP_004525289.1.40388 WP_004525289.1.40390 WP_004525289.1.40448 WP_004525289.1.41588 WP_004525289.1.41945 WP_004525289.1.42408 WP_004525289.1.42492 WP_004525289.1.42496 WP_004525289.1.42800 WP_004525289.1.43136 WP_004525289.1.43156 WP_004525289.1.43373 WP_004525289.1.43542 WP_004525289.1.43581 WP_004525289.1.43587 WP_004525289.1.43727 WP_004525289.1.43786 WP_004525289.1.44352 WP_004525289.1.44414 WP_004525289.1.44824 WP_004525289.1.45284 WP_004525289.1.45348 WP_004525289.1.45537 WP_004525289.1.45715 WP_004525289.1.45890 WP_004525289.1.4631 WP_004525289.1.46575 WP_004525289.1.46757 WP_004525289.1.4693 WP_004525289.1.46969 WP_004525289.1.47086 WP_004525289.1.4718 WP_004525289.1.47564 WP_004525289.1.48093 WP_004525289.1.48165 WP_004525289.1.48464 WP_004525289.1.49026 WP_004525289.1.49717 WP_004525289.1.49872 WP_004525289.1.50174 WP_004525289.1.50336 WP_004525289.1.50401 WP_004525289.1.50839 WP_004525289.1.5105 WP_004525289.1.51606 WP_004525289.1.51666 WP_004525289.1.5173 WP_004525289.1.5182 WP_004525289.1.51874 WP_004525289.1.51891 WP_004525289.1.51902 WP_004525289.1.52229 WP_004525289.1.52365 WP_004525289.1.52451 WP_004525289.1.52547 WP_004525289.1.52643 WP_004525289.1.52731 WP_004525289.1.52760 WP_004525289.1.5292 WP_004525289.1.53034 WP_004525289.1.53048 WP_004525289.1.53103 WP_004525289.1.53132 WP_004525289.1.53386 WP_004525289.1.53506 WP_004525289.1.53578 WP_004525289.1.54016 WP_004525289.1.5413 WP_004525289.1.54369 WP_004525289.1.54859 WP_004525289.1.55038 WP_004525289.1.55415 WP_004525289.1.55691 WP_004525289.1.55755 WP_004525289.1.55974 WP_004525289.1.55996 WP_004525289.1.56126 WP_004525289.1.56248 WP_004525289.1.5641 WP_004525289.1.56458 WP_004525289.1.56591 WP_004525289.1.56744 WP_004525289.1.56993 WP_004525289.1.57046 WP_004525289.1.57247 WP_004525289.1.5734 WP_004525289.1.57341 WP_004525289.1.5776 WP_004525289.1.58003 WP_004525289.1.58105 WP_004525289.1.58190 WP_004525289.1.58355 WP_004525289.1.58362 WP_004525289.1.58405 WP_004525289.1.58509 WP_004525289.1.58523 WP_004525289.1.58578 WP_004525289.1.58639 WP_004525289.1.58758 WP_004525289.1.5883 WP_004525289.1.59103 WP_004525289.1.59200 WP_004525289.1.59422 WP_004525289.1.59519 WP_004525289.1.59549 WP_004525289.1.59747 WP_004525289.1.60398 WP_004525289.1.60769 WP_004525289.1.60810 WP_004525289.1.60833 WP_004525289.1.60836 WP_004525289.1.61084 WP_004525289.1.61202 WP_004525289.1.61455 WP_004525289.1.61685 WP_004525289.1.61723 WP_004525289.1.61854 WP_004525289.1.6186 WP_004525289.1.61900 WP_004525289.1.62103 WP_004525289.1.62183 WP_004525289.1.63261 WP_004525289.1.63361 WP_004525289.1.63439 WP_004525289.1.63505 WP_004525289.1.63661 WP_004525289.1.63942 WP_004525289.1.64068 WP_004525289.1.64096 WP_004525289.1.64166 WP_004525289.1.64364 WP_004525289.1.64383 WP_004525289.1.64892 WP_004525289.1.65093 WP_004525289.1.65270 WP_004525289.1.65468 WP_004525289.1.65994 WP_004525289.1.66321 WP_004525289.1.67013 WP_004525289.1.67117 WP_004525289.1.67182 WP_004525289.1.67229 WP_004525289.1.67559 WP_004525289.1.6765 WP_004525289.1.67860 WP_004525289.1.67909 WP_004525289.1.67978 WP_004525289.1.6835 WP_004525289.1.68353 WP_004525289.1.68664 WP_004525289.1.68886 WP_004525289.1.68922 WP_004525289.1.69022 WP_004525289.1.69081 WP_004525289.1.69106 WP_004525289.1.69169 WP_004525289.1.69217 WP_004525289.1.69337 WP_004525289.1.69354 WP_004525289.1.69770 WP_004525289.1.70016 WP_004525289.1.7006 WP_004525289.1.70066 WP_004525289.1.70096 WP_004525289.1.70278 WP_004525289.1.70280 WP_004525289.1.70735 WP_004525289.1.71444 WP_004525289.1.71564 WP_004525289.1.71901 WP_004525289.1.72015 WP_004525289.1.72817 WP_004525289.1.73317 WP_004525289.1.73418 WP_004525289.1.73521 WP_004525289.1.73576 WP_004525289.1.73974 WP_004525289.1.74425 WP_004525289.1.74569 WP_004525289.1.74690 WP_004525289.1.75001 WP_004525289.1.75027 WP_004525289.1.75075 WP_004525289.1.75276 WP_004525289.1.75519 WP_004525289.1.75677 WP_004525289.1.75708 WP_004525289.1.75711 WP_004525289.1.75913 WP_004525289.1.75937 WP_004525289.1.76142 WP_004525289.1.76290 WP_004525289.1.76432 WP_004525289.1.76522 WP_004525289.1.76575 WP_004525289.1.766 WP_004525289.1.7703 WP_004525289.1.77249 WP_004525289.1.77287 WP_004525289.1.77319 WP_004525289.1.77689 WP_004525289.1.77788 WP_004525289.1.77845 WP_004525289.1.78029 WP_004525289.1.78278 WP_004525289.1.78628 WP_004525289.1.78759 WP_004525289.1.78827 WP_004525289.1.79052 WP_004525289.1.79360 WP_004525289.1.795 WP_004525289.1.79689 WP_004525289.1.79710 WP_004525289.1.79725 WP_004525289.1.80302 WP_004525289.1.80395 WP_004525289.1.80433 WP_004525289.1.80923 WP_004525289.1.81042 WP_004525289.1.8126 WP_004525289.1.81479 WP_004525289.1.81511 WP_004525289.1.81543 WP_004525289.1.81665 WP_004525289.1.82197 WP_004525289.1.82323 WP_004525289.1.82394 WP_004525289.1.82506 WP_004525289.1.82575 WP_004525289.1.82727 WP_004525289.1.82915 WP_004525289.1.83080 WP_004525289.1.83357 WP_004525289.1.8341 WP_004525289.1.83487 WP_004525289.1.83543 WP_004525289.1.83567 WP_004525289.1.83609 WP_004525289.1.83688 WP_004525289.1.8388 WP_004525289.1.8390 WP_004525289.1.8395 WP_004525289.1.83967 WP_004525289.1.84002 WP_004525289.1.84026 WP_004525289.1.84181 WP_004525289.1.84375 WP_004525289.1.84379 WP_004525289.1.84866 WP_004525289.1.85170 WP_004525289.1.85412 WP_004525289.1.85443 WP_004525289.1.85467 WP_004525289.1.85565 WP_004525289.1.856 WP_004525289.1.85641 WP_004525289.1.85645 WP_004525289.1.85774 WP_004525289.1.8585 WP_004525289.1.8629 WP_004525289.1.86295 WP_004525289.1.86438 WP_004525289.1.86525 WP_004525289.1.86806 WP_004525289.1.86872 WP_004525289.1.8697 WP_004525289.1.87114 WP_004525289.1.87278 WP_004525289.1.87324 WP_004525289.1.87652 WP_004525289.1.87759 WP_004525289.1.87811 WP_004525289.1.88003 WP_004525289.1.88237 WP_004525289.1.88322 WP_004525289.1.88369 WP_004525289.1.88666 WP_004525289.1.88682 WP_004525289.1.88764 WP_004525289.1.88920 WP_004525289.1.89093 WP_004525289.1.8912 WP_004525289.1.89240 WP_004525289.1.89435 WP_004525289.1.89514 WP_004525289.1.89782 WP_004525289.1.90471 WP_004525289.1.9079 WP_004525289.1.90934 WP_004525289.1.91025 WP_004525289.1.91142 WP_004525289.1.91700 WP_004525289.1.91709 WP_004525289.1.91823 WP_004525289.1.92095 WP_004525289.1.92406 WP_004525289.1.92430 WP_004525289.1.92493 WP_004525289.1.92507 WP_004525289.1.9280 WP_004525289.1.92904 WP_004525289.1.93845 WP_004525289.1.94023 WP_004525289.1.94050 WP_004525289.1.94117 WP_004525289.1.94121 WP_004525289.1.94498 WP_004525289.1.94520 WP_004525289.1.9479 WP_004525289.1.94901 WP_004525289.1.94926 WP_004525289.1.95054 WP_004525289.1.95300 WP_004525289.1.95339 WP_004525289.1.9537 WP_004525289.1.95420 WP_004525289.1.95587 WP_004525289.1.95644 WP_004525289.1.95672 WP_004525289.1.95938 WP_004525289.1.96381 WP_004525289.1.97058 WP_004525289.1.97112 WP_004525289.1.97148 WP_004525289.1.97989 WP_004525289.1.98218 WP_004525289.1.98316 WP_004525289.1.98491 WP_004525289.1.98547 WP_004525289.1.98688 WP_004525289.1.98753 WP_004525289.1.98768 WP_004525289.1.99061 WP_004525289.1.99069 WP_004525289.1.99160 WP_004525289.1.99233 WP_004525289.1.99290 WP_004525289.1.9962 WP_004525289.1.99629 WP_004525289.1.99741 WP_004525289.1.9983 WP_004525289.1.99890 YP_111580.1.59693 gi|403523395|ref|YP_006658964.1| gi|526458958|ref|YP_008328700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]