SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126457569|ref|YP_001074790.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126457569|ref|YP_001074790.1|
Domain Number 1 Region: 54-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.43e-78
Family Phosphate binding protein-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126457569|ref|YP_001074790.1|
Sequence length 345
Comment quaternary amine ABC transporter periplasmic substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MTPGVTHFQMEQAMKRYESIARRLARRAAAASPAFAALAWCAAAAAATTTAAAAEPAACR
DVRMAGPGWTDIEATNALAGVVLKALGYRQSVSNLSVPITYQGLKKGQLDVFLGNWMPAQ
APLVKPFVDARAIDVLHANLSHAKFTLAVPDYVAAAGVHSFADLAKYAQRFGAKIYGIEP
GAPANQNISRMLADKALGPANWQLVESSETGMLTQVERAVRERQWIVFLGWEPHLMNTKF
HLVYLSGGDAYFGPDYGGATVNTVARADFASQCANLARLFRQMTFTVDLENGMIAAMLQG
KRSAVDAAQHALRANPSLVEAWLDGVRTASGAPGLPAVRAALDAQ
Download sequence
Identical sequences A0A095QK99 A0A0E1TNT2 A0A0E1UP17 A0A0E1VS87 A3NHM0 A3P380 A8EJX9 C4I191
gi|126457569|ref|YP_001074790.1| gi|126442805|ref|YP_001061841.1| 320373.BURPS668_A0842 357348.BURPS1106A_A0754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]