SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126457717|ref|YP_001074372.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126457717|ref|YP_001074372.1|
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.99e-16
Family Phosphate binding protein-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126457717|ref|YP_001074372.1|
Sequence length 131
Comment transcriptional regulator [Burkholderia pseudomallei 1106a]
Sequence
MRGYRERFPRVELELNSNEGVIDLLERRTDVAIRIGRLKDSTLHSRLTGNSRLRILASPA
YLDAHGRPRKAGDLGKHALLGFNRPESLNVWPTSARTASLAGSRRPCGRRATRRSNSSRS
TARASSAGRIS
Download sequence
Identical sequences A0A2K3ESZ0 A3P212
WP_004536638.1.15673 WP_004536638.1.29853 WP_004536638.1.37 WP_004536638.1.3872 WP_004536638.1.39078 WP_004536638.1.39179 WP_004536638.1.41945 WP_004536638.1.43786 WP_004536638.1.5182 WP_004536638.1.52547 WP_004536638.1.52655 WP_004536638.1.54859 WP_004536638.1.55038 WP_004536638.1.5608 WP_004536638.1.56126 WP_004536638.1.56744 WP_004536638.1.57046 WP_004536638.1.64068 WP_004536638.1.64364 WP_004536638.1.64542 WP_004536638.1.70278 WP_004536638.1.76142 WP_004536638.1.766 WP_004536638.1.78807 WP_004536638.1.79360 WP_004536638.1.80395 WP_004536638.1.82506 WP_004536638.1.83543 WP_004536638.1.83567 WP_004536638.1.83688 WP_004536638.1.84026 WP_004536638.1.86806 WP_004536638.1.88237 WP_004536638.1.91025 WP_004536638.1.92493 WP_004536638.1.98768 WP_004536638.1.9962 357348.BURPS1106A_A0329 gi|126457717|ref|YP_001074372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]