SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126457878|ref|YP_001074489.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126457878|ref|YP_001074489.1|
Domain Number 1 Region: 42-279
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-70
Family Phosphate binding protein-like 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126457878|ref|YP_001074489.1|
Sequence length 279
Comment methionine ABC transporter periiplasmic amino-acid binding protein [Burkholderia pseudomallei 1106a]
Sequence
MQSRLFLARLLRRASRAAAAAFALAVFAEFAVPLAHADSTPLKVGIATSPQIDALKVAAK
EAKAQGLDVKIIEFTDWNTPNAALANQDIDVNYFQHIPFLENAKKQRGYDFVAIAPGTIM
KIGLYSKKIKSFDQLKNGATVAIANDPVNGGRGLLLLQRAGLIALKPGADYRATTRDIVS
NPKHLKILQLEASQLARSLDDVDLAQGYPSFIKLAGTADPNGALLFDGLENKLFALQWVV
RPERANDPRIRRFIAIYQHSPAVRQALDDAFGRLYAIAW
Download sequence
Identical sequences A0A069B742 A0A0E1TVI3 A0A0E1UQU1 A0A0E1VW68 A0A0F6LG03 A0A0H2WC69 A0A0H3HUT7 A0A290YG88 A0A2K3EZB6 A0A2K3G3S9 A0A2K3HA49 A0A2K3HZS1 A2S1Z4 A3P2C9 A8EIT5 B1HBW8 C4AQ81 C4I738 Q63NI6
gi|126446455|ref|YP_001078055.1| 243160.BMAA1441 272560.BPSS0313 320389.BMA10247_A0856 357348.BURPS1106A_A0446 412022.BMA10229_2172 gi|403521716|ref|YP_006657285.1| gi|386864070|ref|YP_006277018.1| gi|126457878|ref|YP_001074489.1| WP_004188447.1.100104 WP_004188447.1.100195 WP_004188447.1.10047 WP_004188447.1.100583 WP_004188447.1.100720 WP_004188447.1.100727 WP_004188447.1.100825 WP_004188447.1.100900 WP_004188447.1.1010 WP_004188447.1.101060 WP_004188447.1.101307 WP_004188447.1.101381 WP_004188447.1.101559 WP_004188447.1.101588 WP_004188447.1.101783 WP_004188447.1.10269 WP_004188447.1.10359 WP_004188447.1.10553 WP_004188447.1.10633 WP_004188447.1.10907 WP_004188447.1.1098 WP_004188447.1.11046 WP_004188447.1.11072 WP_004188447.1.11160 WP_004188447.1.11268 WP_004188447.1.11404 WP_004188447.1.11747 WP_004188447.1.11825 WP_004188447.1.11893 WP_004188447.1.12731 WP_004188447.1.12793 WP_004188447.1.12856 WP_004188447.1.12860 WP_004188447.1.13309 WP_004188447.1.13520 WP_004188447.1.13597 WP_004188447.1.13639 WP_004188447.1.13925 WP_004188447.1.13950 WP_004188447.1.14539 WP_004188447.1.1465 WP_004188447.1.14660 WP_004188447.1.15170 WP_004188447.1.15364 WP_004188447.1.15525 WP_004188447.1.15673 WP_004188447.1.16090 WP_004188447.1.16113 WP_004188447.1.16249 WP_004188447.1.16358 WP_004188447.1.16540 WP_004188447.1.16561 WP_004188447.1.16625 WP_004188447.1.16680 WP_004188447.1.16689 WP_004188447.1.16749 WP_004188447.1.17067 WP_004188447.1.17068 WP_004188447.1.17278 WP_004188447.1.17473 WP_004188447.1.17748 WP_004188447.1.17786 WP_004188447.1.18396 WP_004188447.1.18405 WP_004188447.1.18549 WP_004188447.1.18631 WP_004188447.1.18704 WP_004188447.1.18744 WP_004188447.1.18906 WP_004188447.1.19486 WP_004188447.1.19629 WP_004188447.1.1976 WP_004188447.1.19815 WP_004188447.1.19854 WP_004188447.1.20021 WP_004188447.1.20246 WP_004188447.1.20520 WP_004188447.1.20531 WP_004188447.1.20673 WP_004188447.1.21147 WP_004188447.1.21205 WP_004188447.1.21291 WP_004188447.1.21304 WP_004188447.1.21442 WP_004188447.1.21461 WP_004188447.1.21809 WP_004188447.1.21907 WP_004188447.1.22046 WP_004188447.1.22299 WP_004188447.1.22308 WP_004188447.1.22329 WP_004188447.1.2261 WP_004188447.1.22625 WP_004188447.1.23086 WP_004188447.1.23104 WP_004188447.1.2317 WP_004188447.1.23385 WP_004188447.1.23743 WP_004188447.1.23852 WP_004188447.1.23994 WP_004188447.1.24020 WP_004188447.1.24134 WP_004188447.1.24314 WP_004188447.1.24372 WP_004188447.1.24454 WP_004188447.1.24513 WP_004188447.1.2462 WP_004188447.1.24701 WP_004188447.1.25068 WP_004188447.1.25102 WP_004188447.1.25412 WP_004188447.1.25628 WP_004188447.1.26054 WP_004188447.1.26502 WP_004188447.1.26535 WP_004188447.1.26565 WP_004188447.1.26633 WP_004188447.1.26645 WP_004188447.1.267 WP_004188447.1.26838 WP_004188447.1.26849 WP_004188447.1.27064 WP_004188447.1.27069 WP_004188447.1.27146 WP_004188447.1.27363 WP_004188447.1.27390 WP_004188447.1.27399 WP_004188447.1.27420 WP_004188447.1.27597 WP_004188447.1.27810 WP_004188447.1.27909 WP_004188447.1.28018 WP_004188447.1.28187 WP_004188447.1.28453 WP_004188447.1.28594 WP_004188447.1.29161 WP_004188447.1.29335 WP_004188447.1.29508 WP_004188447.1.29520 WP_004188447.1.29547 WP_004188447.1.29658 WP_004188447.1.29853 WP_004188447.1.29878 WP_004188447.1.29887 WP_004188447.1.29899 WP_004188447.1.29948 WP_004188447.1.30311 WP_004188447.1.30382 WP_004188447.1.30671 WP_004188447.1.3069 WP_004188447.1.30729 WP_004188447.1.30937 WP_004188447.1.30966 WP_004188447.1.31343 WP_004188447.1.31831 WP_004188447.1.32174 WP_004188447.1.32182 WP_004188447.1.32221 WP_004188447.1.324 WP_004188447.1.3251 WP_004188447.1.3273 WP_004188447.1.32951 WP_004188447.1.33077 WP_004188447.1.33087 WP_004188447.1.33130 WP_004188447.1.33157 WP_004188447.1.33158 WP_004188447.1.332 WP_004188447.1.33366 WP_004188447.1.33419 WP_004188447.1.33493 WP_004188447.1.33543 WP_004188447.1.33573 WP_004188447.1.33779 WP_004188447.1.34230 WP_004188447.1.34393 WP_004188447.1.34564 WP_004188447.1.34747 WP_004188447.1.35025 WP_004188447.1.35052 WP_004188447.1.35090 WP_004188447.1.35141 WP_004188447.1.35227 WP_004188447.1.35249 WP_004188447.1.35474 WP_004188447.1.35485 WP_004188447.1.35491 WP_004188447.1.35825 WP_004188447.1.36106 WP_004188447.1.36174 WP_004188447.1.36259 WP_004188447.1.36527 WP_004188447.1.366 WP_004188447.1.36662 WP_004188447.1.36666 WP_004188447.1.36944 WP_004188447.1.37 WP_004188447.1.3706 WP_004188447.1.37373 WP_004188447.1.37428 WP_004188447.1.37446 WP_004188447.1.37535 WP_004188447.1.37581 WP_004188447.1.37622 WP_004188447.1.37627 WP_004188447.1.37690 WP_004188447.1.37725 WP_004188447.1.37934 WP_004188447.1.37994 WP_004188447.1.38115 WP_004188447.1.38442 WP_004188447.1.38490 WP_004188447.1.38683 WP_004188447.1.3872 WP_004188447.1.38810 WP_004188447.1.38946 WP_004188447.1.39078 WP_004188447.1.39162 WP_004188447.1.39179 WP_004188447.1.39349 WP_004188447.1.3947 WP_004188447.1.39595 WP_004188447.1.39757 WP_004188447.1.39898 WP_004188447.1.40021 WP_004188447.1.40191 WP_004188447.1.40235 WP_004188447.1.40275 WP_004188447.1.40388 WP_004188447.1.40390 WP_004188447.1.40426 WP_004188447.1.40448 WP_004188447.1.41477 WP_004188447.1.41945 WP_004188447.1.42408 WP_004188447.1.42492 WP_004188447.1.42496 WP_004188447.1.43136 WP_004188447.1.43156 WP_004188447.1.43373 WP_004188447.1.43542 WP_004188447.1.43581 WP_004188447.1.43587 WP_004188447.1.43727 WP_004188447.1.43786 WP_004188447.1.43899 WP_004188447.1.44179 WP_004188447.1.44234 WP_004188447.1.44352 WP_004188447.1.44414 WP_004188447.1.44540 WP_004188447.1.44824 WP_004188447.1.45284 WP_004188447.1.45348 WP_004188447.1.45537 WP_004188447.1.45715 WP_004188447.1.4631 WP_004188447.1.46575 WP_004188447.1.46757 WP_004188447.1.46829 WP_004188447.1.4693 WP_004188447.1.46969 WP_004188447.1.47086 WP_004188447.1.4718 WP_004188447.1.47564 WP_004188447.1.48093 WP_004188447.1.4810 WP_004188447.1.48165 WP_004188447.1.48313 WP_004188447.1.48407 WP_004188447.1.48464 WP_004188447.1.49026 WP_004188447.1.49717 WP_004188447.1.49872 WP_004188447.1.50174 WP_004188447.1.50336 WP_004188447.1.50401 WP_004188447.1.50636 WP_004188447.1.50839 WP_004188447.1.51606 WP_004188447.1.51666 WP_004188447.1.5173 WP_004188447.1.5182 WP_004188447.1.51874 WP_004188447.1.51891 WP_004188447.1.51902 WP_004188447.1.52229 WP_004188447.1.52365 WP_004188447.1.52407 WP_004188447.1.52451 WP_004188447.1.52521 WP_004188447.1.52547 WP_004188447.1.52643 WP_004188447.1.52655 WP_004188447.1.52731 WP_004188447.1.52760 WP_004188447.1.5292 WP_004188447.1.53034 WP_004188447.1.53048 WP_004188447.1.53103 WP_004188447.1.53132 WP_004188447.1.53282 WP_004188447.1.5338 WP_004188447.1.53506 WP_004188447.1.53578 WP_004188447.1.53977 WP_004188447.1.54016 WP_004188447.1.5413 WP_004188447.1.54312 WP_004188447.1.54369 WP_004188447.1.54804 WP_004188447.1.54859 WP_004188447.1.54892 WP_004188447.1.55038 WP_004188447.1.55415 WP_004188447.1.55974 WP_004188447.1.55996 WP_004188447.1.5608 WP_004188447.1.56126 WP_004188447.1.56248 WP_004188447.1.5641 WP_004188447.1.56451 WP_004188447.1.56591 WP_004188447.1.56744 WP_004188447.1.56993 WP_004188447.1.57046 WP_004188447.1.57096 WP_004188447.1.57247 WP_004188447.1.57341 WP_004188447.1.5776 WP_004188447.1.58003 WP_004188447.1.58190 WP_004188447.1.58355 WP_004188447.1.58362 WP_004188447.1.58390 WP_004188447.1.58405 WP_004188447.1.58509 WP_004188447.1.58523 WP_004188447.1.58578 WP_004188447.1.58639 WP_004188447.1.58758 WP_004188447.1.59103 WP_004188447.1.59200 WP_004188447.1.59255 WP_004188447.1.59422 WP_004188447.1.59519 WP_004188447.1.59549 WP_004188447.1.59747 WP_004188447.1.60398 WP_004188447.1.60810 WP_004188447.1.60833 WP_004188447.1.60836 WP_004188447.1.60969 WP_004188447.1.61073 WP_004188447.1.61084 WP_004188447.1.61202 WP_004188447.1.61455 WP_004188447.1.61685 WP_004188447.1.61723 WP_004188447.1.61854 WP_004188447.1.6186 WP_004188447.1.62183 WP_004188447.1.62774 WP_004188447.1.63097 WP_004188447.1.63261 WP_004188447.1.63379 WP_004188447.1.63505 WP_004188447.1.63719 WP_004188447.1.63942 WP_004188447.1.64068 WP_004188447.1.64096 WP_004188447.1.64166 WP_004188447.1.64364 WP_004188447.1.64383 WP_004188447.1.64542 WP_004188447.1.64683 WP_004188447.1.64892 WP_004188447.1.65093 WP_004188447.1.65270 WP_004188447.1.65468 WP_004188447.1.65832 WP_004188447.1.65994 WP_004188447.1.66257 WP_004188447.1.66380 WP_004188447.1.66465 WP_004188447.1.67117 WP_004188447.1.67182 WP_004188447.1.67229 WP_004188447.1.67393 WP_004188447.1.67559 WP_004188447.1.6765 WP_004188447.1.67860 WP_004188447.1.67909 WP_004188447.1.67914 WP_004188447.1.67978 WP_004188447.1.6835 WP_004188447.1.68353 WP_004188447.1.68515 WP_004188447.1.68664 WP_004188447.1.68886 WP_004188447.1.68922 WP_004188447.1.69022 WP_004188447.1.69081 WP_004188447.1.69094 WP_004188447.1.69106 WP_004188447.1.69217 WP_004188447.1.69354 WP_004188447.1.69508 WP_004188447.1.69770 WP_004188447.1.70016 WP_004188447.1.7006 WP_004188447.1.70066 WP_004188447.1.70278 WP_004188447.1.70280 WP_004188447.1.70735 WP_004188447.1.71392 WP_004188447.1.71444 WP_004188447.1.71564 WP_004188447.1.71901 WP_004188447.1.72015 WP_004188447.1.72083 WP_004188447.1.72545 WP_004188447.1.72798 WP_004188447.1.72817 WP_004188447.1.73317 WP_004188447.1.73418 WP_004188447.1.73521 WP_004188447.1.73576 WP_004188447.1.73906 WP_004188447.1.73974 WP_004188447.1.74425 WP_004188447.1.74569 WP_004188447.1.74675 WP_004188447.1.74690 WP_004188447.1.75001 WP_004188447.1.75075 WP_004188447.1.75519 WP_004188447.1.75677 WP_004188447.1.75711 WP_004188447.1.75861 WP_004188447.1.75913 WP_004188447.1.75937 WP_004188447.1.76142 WP_004188447.1.76290 WP_004188447.1.76522 WP_004188447.1.766 WP_004188447.1.7703 WP_004188447.1.77249 WP_004188447.1.77287 WP_004188447.1.77319 WP_004188447.1.77689 WP_004188447.1.77788 WP_004188447.1.78029 WP_004188447.1.78278 WP_004188447.1.78628 WP_004188447.1.78759 WP_004188447.1.78807 WP_004188447.1.78827 WP_004188447.1.79052 WP_004188447.1.79360 WP_004188447.1.79653 WP_004188447.1.79689 WP_004188447.1.79710 WP_004188447.1.79725 WP_004188447.1.79782 WP_004188447.1.80302 WP_004188447.1.80395 WP_004188447.1.80433 WP_004188447.1.80614 WP_004188447.1.80923 WP_004188447.1.81042 WP_004188447.1.8126 WP_004188447.1.81479 WP_004188447.1.81511 WP_004188447.1.81543 WP_004188447.1.81665 WP_004188447.1.82283 WP_004188447.1.82323 WP_004188447.1.82394 WP_004188447.1.82506 WP_004188447.1.82694 WP_004188447.1.82727 WP_004188447.1.82915 WP_004188447.1.82950 WP_004188447.1.83080 WP_004188447.1.83357 WP_004188447.1.8341 WP_004188447.1.83487 WP_004188447.1.83543 WP_004188447.1.83567 WP_004188447.1.83609 WP_004188447.1.83688 WP_004188447.1.8388 WP_004188447.1.8390 WP_004188447.1.83967 WP_004188447.1.84002 WP_004188447.1.84026 WP_004188447.1.84063 WP_004188447.1.84181 WP_004188447.1.84379 WP_004188447.1.84480 WP_004188447.1.84866 WP_004188447.1.85170 WP_004188447.1.85412 WP_004188447.1.85467 WP_004188447.1.85490 WP_004188447.1.85565 WP_004188447.1.85584 WP_004188447.1.856 WP_004188447.1.85645 WP_004188447.1.85774 WP_004188447.1.8585 WP_004188447.1.8629 WP_004188447.1.86295 WP_004188447.1.86438 WP_004188447.1.86525 WP_004188447.1.86806 WP_004188447.1.8697 WP_004188447.1.87114 WP_004188447.1.87278 WP_004188447.1.87324 WP_004188447.1.87652 WP_004188447.1.87759 WP_004188447.1.87811 WP_004188447.1.88117 WP_004188447.1.88168 WP_004188447.1.88237 WP_004188447.1.88322 WP_004188447.1.88369 WP_004188447.1.88411 WP_004188447.1.88666 WP_004188447.1.88682 WP_004188447.1.88764 WP_004188447.1.88920 WP_004188447.1.8912 WP_004188447.1.89240 WP_004188447.1.89435 WP_004188447.1.89514 WP_004188447.1.89782 WP_004188447.1.90079 WP_004188447.1.90471 WP_004188447.1.9079 WP_004188447.1.90934 WP_004188447.1.91025 WP_004188447.1.91142 WP_004188447.1.91198 WP_004188447.1.91709 WP_004188447.1.91763 WP_004188447.1.91823 WP_004188447.1.92095 WP_004188447.1.9236 WP_004188447.1.92367 WP_004188447.1.92406 WP_004188447.1.92430 WP_004188447.1.92493 WP_004188447.1.9280 WP_004188447.1.9281 WP_004188447.1.93845 WP_004188447.1.94023 WP_004188447.1.94117 WP_004188447.1.94121 WP_004188447.1.94403 WP_004188447.1.94498 WP_004188447.1.94520 WP_004188447.1.9479 WP_004188447.1.94901 WP_004188447.1.95300 WP_004188447.1.95339 WP_004188447.1.95420 WP_004188447.1.95587 WP_004188447.1.95644 WP_004188447.1.95672 WP_004188447.1.95938 WP_004188447.1.95952 WP_004188447.1.96381 WP_004188447.1.97058 WP_004188447.1.97112 WP_004188447.1.97989 WP_004188447.1.98316 WP_004188447.1.98547 WP_004188447.1.98688 WP_004188447.1.98713 WP_004188447.1.98753 WP_004188447.1.98768 WP_004188447.1.98944 WP_004188447.1.99061 WP_004188447.1.99069 WP_004188447.1.99160 WP_004188447.1.99233 WP_004188447.1.99290 WP_004188447.1.9962 WP_004188447.1.99629 WP_004188447.1.99741 WP_004188447.1.9975 WP_004188447.1.9983 WP_004188447.1.99890 WP_004188447.1.99919 YP_106046.1.87047 YP_110333.1.59693 gi|124383183|ref|YP_001025965.1| gi|53717014|ref|YP_106046.1| gi|53721348|ref|YP_110333.1| gi|556573507|ref|YP_008741977.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]