SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126457885|ref|YP_001074785.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126457885|ref|YP_001074785.1|
Domain Number 1 Region: 27-286
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.02e-73
Family Phosphate binding protein-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126457885|ref|YP_001074785.1|
Sequence length 287
Comment quaternary amine ABC transporter periplasmic substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKFLTKLIGCGVLAMMLAAVAPTQADTKPTLKIGYVEGWDDSVATSNVAARIIETKLGYP
VQLVPVAAGVMWQGVARGDLDATLSAWLPVTQGAYWEQFKTKVVNLGTNFPDAKIGLIVP
AYVKAKTIADLNAQKNDFAGRIVGIDAGAGVMRKTDDAIKAYGLNYSLMPSSGSAMTAEL
ARSIHSNKAVVVTGWAPHWMFAKWKLRFLDDPKKVYGEAEHVDNVVNPALETKAQPVVAF
LKKFQWKPGEIDGVMLAIQNGSKPAAAADAWIAAHGDRVGEWLGAER
Download sequence
Identical sequences A0A095IZR3 A0A0E1S124 A0A0E1TLV7 A0A0E1UX71 A0A0H2WDC5 A0A0H3HSQ0 A0A290YIK4 A0A2K3G5L8 A2RYN6 A3NHL5 A3P375 B1HM23 C4AZU5 Q63MU2
WP_004186918.1.100104 WP_004186918.1.10047 WP_004186918.1.100720 WP_004186918.1.100900 WP_004186918.1.10359 WP_004186918.1.10907 WP_004186918.1.11072 WP_004186918.1.11747 WP_004186918.1.11996 WP_004186918.1.11998 WP_004186918.1.1266 WP_004186918.1.12856 WP_004186918.1.13198 WP_004186918.1.13309 WP_004186918.1.13504 WP_004186918.1.13520 WP_004186918.1.13603 WP_004186918.1.13639 WP_004186918.1.14539 WP_004186918.1.15170 WP_004186918.1.15364 WP_004186918.1.15525 WP_004186918.1.16090 WP_004186918.1.16113 WP_004186918.1.16249 WP_004186918.1.16358 WP_004186918.1.16540 WP_004186918.1.16625 WP_004186918.1.16689 WP_004186918.1.17473 WP_004186918.1.17748 WP_004186918.1.18396 WP_004186918.1.18549 WP_004186918.1.18631 WP_004186918.1.19540 WP_004186918.1.1976 WP_004186918.1.19854 WP_004186918.1.20501 WP_004186918.1.20531 WP_004186918.1.20673 WP_004186918.1.21147 WP_004186918.1.21205 WP_004186918.1.21653 WP_004186918.1.21907 WP_004186918.1.22308 WP_004186918.1.22329 WP_004186918.1.22779 WP_004186918.1.23009 WP_004186918.1.23385 WP_004186918.1.23994 WP_004186918.1.24372 WP_004186918.1.25102 WP_004186918.1.25265 WP_004186918.1.25412 WP_004186918.1.25628 WP_004186918.1.259 WP_004186918.1.26445 WP_004186918.1.27069 WP_004186918.1.27146 WP_004186918.1.27420 WP_004186918.1.2767 WP_004186918.1.28066 WP_004186918.1.28187 WP_004186918.1.28453 WP_004186918.1.28594 WP_004186918.1.28619 WP_004186918.1.29148 WP_004186918.1.29161 WP_004186918.1.29335 WP_004186918.1.29405 WP_004186918.1.29520 WP_004186918.1.29547 WP_004186918.1.29658 WP_004186918.1.29853 WP_004186918.1.29887 WP_004186918.1.29899 WP_004186918.1.30311 WP_004186918.1.30671 WP_004186918.1.3069 WP_004186918.1.30937 WP_004186918.1.31723 WP_004186918.1.31831 WP_004186918.1.32221 WP_004186918.1.324 WP_004186918.1.32581 WP_004186918.1.33130 WP_004186918.1.33157 WP_004186918.1.33419 WP_004186918.1.33493 WP_004186918.1.33543 WP_004186918.1.34230 WP_004186918.1.34333 WP_004186918.1.34747 WP_004186918.1.35025 WP_004186918.1.35052 WP_004186918.1.35141 WP_004186918.1.35249 WP_004186918.1.35474 WP_004186918.1.35757 WP_004186918.1.35878 WP_004186918.1.36174 WP_004186918.1.36666 WP_004186918.1.36944 WP_004186918.1.37373 WP_004186918.1.37446 WP_004186918.1.37517 WP_004186918.1.37519 WP_004186918.1.37627 WP_004186918.1.37690 WP_004186918.1.37959 WP_004186918.1.38115 WP_004186918.1.38490 WP_004186918.1.38683 WP_004186918.1.3872 WP_004186918.1.38946 WP_004186918.1.39078 WP_004186918.1.39162 WP_004186918.1.39179 WP_004186918.1.39757 WP_004186918.1.39898 WP_004186918.1.40191 WP_004186918.1.40426 WP_004186918.1.41477 WP_004186918.1.42492 WP_004186918.1.43136 WP_004186918.1.43581 WP_004186918.1.43786 WP_004186918.1.43899 WP_004186918.1.44414 WP_004186918.1.44540 WP_004186918.1.44824 WP_004186918.1.45348 WP_004186918.1.45356 WP_004186918.1.46829 WP_004186918.1.46969 WP_004186918.1.47149 WP_004186918.1.4810 WP_004186918.1.48165 WP_004186918.1.48313 WP_004186918.1.48464 WP_004186918.1.49717 WP_004186918.1.50320 WP_004186918.1.50401 WP_004186918.1.50636 WP_004186918.1.50839 WP_004186918.1.51606 WP_004186918.1.5173 WP_004186918.1.52229 WP_004186918.1.52407 WP_004186918.1.52521 WP_004186918.1.52547 WP_004186918.1.52643 WP_004186918.1.52731 WP_004186918.1.52882 WP_004186918.1.5292 WP_004186918.1.53034 WP_004186918.1.53048 WP_004186918.1.53132 WP_004186918.1.53282 WP_004186918.1.53506 WP_004186918.1.53977 WP_004186918.1.54016 WP_004186918.1.54312 WP_004186918.1.54369 WP_004186918.1.54804 WP_004186918.1.54892 WP_004186918.1.55691 WP_004186918.1.55755 WP_004186918.1.5608 WP_004186918.1.56248 WP_004186918.1.5641 WP_004186918.1.56451 WP_004186918.1.56591 WP_004186918.1.57247 WP_004186918.1.57341 WP_004186918.1.57359 WP_004186918.1.57679 WP_004186918.1.5776 WP_004186918.1.58003 WP_004186918.1.58578 WP_004186918.1.59103 WP_004186918.1.59422 WP_004186918.1.59496 WP_004186918.1.59519 WP_004186918.1.59536 WP_004186918.1.60398 WP_004186918.1.60810 WP_004186918.1.61084 WP_004186918.1.61685 WP_004186918.1.61723 WP_004186918.1.6186 WP_004186918.1.62774 WP_004186918.1.63097 WP_004186918.1.63261 WP_004186918.1.63439 WP_004186918.1.63505 WP_004186918.1.63942 WP_004186918.1.64204 WP_004186918.1.64364 WP_004186918.1.64383 WP_004186918.1.64892 WP_004186918.1.65270 WP_004186918.1.66257 WP_004186918.1.66321 WP_004186918.1.66380 WP_004186918.1.67117 WP_004186918.1.67393 WP_004186918.1.67559 WP_004186918.1.6765 WP_004186918.1.67860 WP_004186918.1.67909 WP_004186918.1.68886 WP_004186918.1.68922 WP_004186918.1.69081 WP_004186918.1.69106 WP_004186918.1.69169 WP_004186918.1.69337 WP_004186918.1.69508 WP_004186918.1.69918 WP_004186918.1.7006 WP_004186918.1.70066 WP_004186918.1.70278 WP_004186918.1.70280 WP_004186918.1.71392 WP_004186918.1.71444 WP_004186918.1.71564 WP_004186918.1.71901 WP_004186918.1.72015 WP_004186918.1.72083 WP_004186918.1.72545 WP_004186918.1.72817 WP_004186918.1.73521 WP_004186918.1.73576 WP_004186918.1.73974 WP_004186918.1.74425 WP_004186918.1.7450 WP_004186918.1.74675 WP_004186918.1.74690 WP_004186918.1.75027 WP_004186918.1.75075 WP_004186918.1.75519 WP_004186918.1.75677 WP_004186918.1.75708 WP_004186918.1.75711 WP_004186918.1.75776 WP_004186918.1.75861 WP_004186918.1.75883 WP_004186918.1.75937 WP_004186918.1.76142 WP_004186918.1.76290 WP_004186918.1.76522 WP_004186918.1.766 WP_004186918.1.77249 WP_004186918.1.77689 WP_004186918.1.77845 WP_004186918.1.78557 WP_004186918.1.78628 WP_004186918.1.78759 WP_004186918.1.79052 WP_004186918.1.79653 WP_004186918.1.79725 WP_004186918.1.80098 WP_004186918.1.80302 WP_004186918.1.80395 WP_004186918.1.80433 WP_004186918.1.80923 WP_004186918.1.81511 WP_004186918.1.82197 WP_004186918.1.82283 WP_004186918.1.82394 WP_004186918.1.82950 WP_004186918.1.83543 WP_004186918.1.83609 WP_004186918.1.83688 WP_004186918.1.8388 WP_004186918.1.8390 WP_004186918.1.84002 WP_004186918.1.84026 WP_004186918.1.84375 WP_004186918.1.84480 WP_004186918.1.84654 WP_004186918.1.84866 WP_004186918.1.85412 WP_004186918.1.85467 WP_004186918.1.85584 WP_004186918.1.85641 WP_004186918.1.8585 WP_004186918.1.86525 WP_004186918.1.86806 WP_004186918.1.8697 WP_004186918.1.87278 WP_004186918.1.87324 WP_004186918.1.87553 WP_004186918.1.88003 WP_004186918.1.88117 WP_004186918.1.88168 WP_004186918.1.88237 WP_004186918.1.89093 WP_004186918.1.89514 WP_004186918.1.90934 WP_004186918.1.91025 WP_004186918.1.91142 WP_004186918.1.9236 WP_004186918.1.92367 WP_004186918.1.92430 WP_004186918.1.92507 WP_004186918.1.9280 WP_004186918.1.9281 WP_004186918.1.92904 WP_004186918.1.93844 WP_004186918.1.93845 WP_004186918.1.94050 WP_004186918.1.94117 WP_004186918.1.94121 WP_004186918.1.94286 WP_004186918.1.94403 WP_004186918.1.94498 WP_004186918.1.94520 WP_004186918.1.9479 WP_004186918.1.94901 WP_004186918.1.94926 WP_004186918.1.95300 WP_004186918.1.95587 WP_004186918.1.95644 WP_004186918.1.95952 WP_004186918.1.96381 WP_004186918.1.96660 WP_004186918.1.97058 WP_004186918.1.97112 WP_004186918.1.97148 WP_004186918.1.98066 WP_004186918.1.98547 WP_004186918.1.98688 WP_004186918.1.98713 WP_004186918.1.98944 WP_004186918.1.99160 WP_004186918.1.9962 WP_004186918.1.99629 WP_004186918.1.9975 WP_004186918.1.99890 WP_004186918.1.99919 YP_105252.1.87047 YP_110577.1.59693 gi|386864327|ref|YP_006277275.1| gi|556573498|ref|YP_008740389.1| 243160.BMAA0480 272560.BPSS0556 320373.BURPS668_A0837 320388.BMASAVP1_0701 320389.BMA10247_A1970 357348.BURPS1106A_A0749 412022.BMA10229_0997 gi|126457885|ref|YP_001074785.1| gi|53717109|ref|YP_105252.1| gi|126446876|ref|YP_001079146.1| gi|53721592|ref|YP_110577.1| gi|403522079|ref|YP_006657648.1| gi|126444469|ref|YP_001061836.1| gi|526459282|ref|YP_008327570.1| gi|121598022|ref|YP_990306.1| gi|124381642|ref|YP_001024805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]