SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529063771|ref|YP_008372934.1| from Cycloclasticus zancles 7-ME

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529063771|ref|YP_008372934.1|
Domain Number 1 Region: 116-515
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.98e-60
Family GABA-aminotransferase-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529063771|ref|YP_008372934.1|
Sequence length 559
Comment Glutamate-1-semialdehyde aminotransferase [Cycloclasticus zancles 7-ME]
Sequence
MPDTDVFYTALALLSFFFLIKVSTRLKLSRAKHPSVRGHSKWARRIAKWVPYFSYDEEAF
FSSDEAPIAVVNQRKKGFKQLSESLACHSPKSTGFYASLEDSVSDVRFTNLYRVPYPYRN
YLGEHIKPASIVTESSGVMLKDLDGRCGVDLSGSYGVNVFGYDFYKSCLKKGFENAQNLG
PVLGPYHPIIKNNVEELKRISGLDEVSFHMSGTEAVMQAVRLARYHTGKRYLVRFCGAYH
GWWDGVQPGIGNQRKTNDVYTLRDMSERTLSILRTRRDIACVLVNPLQGLHPNSDASSDA
MLVNSEREAAFDKTAYSEWLQKLQQVCKERSIVLIFDEVFTGFRLSHKGAQGFFAVQADL
VTYGKTVGGGLPVGVLCGRHHLMQRFKEDRPANVSFARGTFNSHPYVMTSMGAFLQAVQA
EDIQRSYQVLEQVWNDRVQQMNQALNEAGVPVKLANLSSILTVLYTQPSRYNWMYQYYLR
NEGILLSWIGTGRLIMSHNFTDEEFAEVIKRFVSAGVKMKKDGWWWQESALTNKWIKRRM
LKDMVKSVSAKRLVKEAKR
Download sequence
Identical sequences S5TU83
WP_020931886.1.1351 gi|529063771|ref|YP_008372934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]