SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126460789|ref|YP_001041903.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126460789|ref|YP_001041903.1|
Domain Number 1 Region: 114-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.48e-42
Family Extended AAA-ATPase domain 0.000016
Further Details:      
 
Domain Number 2 Region: 352-454
Classification Level Classification E-value
Superfamily TrpR-like 4.45e-38
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126460789|ref|YP_001041903.1|
Sequence length 455
Comment chromosomal replication initiation protein [Rhodobacter sphaeroides ATCC 17029]
Sequence
MTNETWVQVREGLLKRVGRNNFVTWIEPLRLMGLDEGVARFEVPTLFFGDWVQRNFADHI
RMRLTEAGSPVERLEFAVSNTPRAPLKEVKAAAPAASPARARPAPPEEDLRGAPLDARFT
FDSFVVGKPNELAHAAARRVAEGGPVTFNPLFLYGGVGLGKTHLMHAIAHDLQKRQPGAR
VLYLSAEQFMYRFVQALREREILGFKELFRSVDVLMVDDVQFIAGKDSTQEEFFHTFNAL
VDQNKQIVISADRAPGEIKDLEERIKSRLQCGLVVDLHPTDYELRLGILQQKADFYREQY
RGLVIADGVLEFLAHRITTNVRVLEGALTRLFAFASLVGREITLDLAQDCLADILRASDR
KVTIEEIQRKVAEHYNIRLSDMIGPKRLRTIARPRQVAMYLAKQLTPRSLPEIGRRFGGR
DHTTIMHGVRKIEELMATDSQLADDLQLLRRLLQA
Download sequence
Identical sequences A0A239GM75 A3PFL5 Q3IY61
gi|126460789|ref|YP_001041903.1| RhR120 WP_002721917.1.19875 WP_002721917.1.22285 WP_002721917.1.22689 WP_002721917.1.29994 WP_002721917.1.39940 WP_002721917.1.46944 WP_002721917.1.62547 WP_002721917.1.80699 WP_002721917.1.8565 YP_354424.1.90827 gi|77464920|ref|YP_354424.1| 272943.RSP_1342 349101.Rsph17029_0011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]