SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126461387|ref|YP_001042501.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126461387|ref|YP_001042501.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000000214
Family SPO1678-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126461387|ref|YP_001042501.1|
Sequence length 105
Comment IS3 family transposase orfA [Rhodobacter sphaeroides ATCC 17029]
Sequence
MSVTMDDPIKRWTAKRKTALVVEIIQGKTTVAEASRSYDLSPSEIEGWVEDAKRGMENAL
RANPLDIREQYEKQLKDLQEAYGEAMLELRARKKLAALMEREDGN
Download sequence
Identical sequences A3PHB3
349101.Rsph17029_0615 349101.Rsph17029_0753 349101.Rsph17029_3533 gi|126461387|ref|YP_001042501.1| gi|126461523|ref|YP_001042637.1| gi|126464284|ref|YP_001045397.1| WP_011840471.1.46944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]