SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126461950|ref|YP_001043064.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126461950|ref|YP_001043064.1|
Domain Number 1 Region: 225-616
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 7.61e-90
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000829
Further Details:      
 
Domain Number 2 Region: 87-223
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1e-35
Family Ferredoxin domains from multidomain proteins 0.0002
Further Details:      
 
Domain Number 3 Region: 6-71
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.14e-18
Family 2Fe-2S ferredoxin-related 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126461950|ref|YP_001043064.1|
Sequence length 673
Comment NADH dehydrogenase subunit G [Rhodobacter sphaeroides ATCC 17029]
Sequence
MSNLKKIIIDGIEVEVDGAMTLLQAAEEVGIEIPRFCYHERLSIAGNCRMCLVEVVGGPP
KPTASCAMQVRDLRPGPNGEAPVVKTNSPMVKKAREGVMEFLLINHPLDCPICDQGGECD
LQDQAMAYGVDFSRYREPKRASENLNLGPLVATQMTRCISCTRCVRFTTEVAGITQMGQT
GRGEDSEITSYLNQTLDSNLQGNIIDLCPVGALTSKPYAFTARPWELGKTESIDVMDALG
SNIRVDTKGREVMRILPRNHDGVNEEWISDKTRFVWDGLRRQRLDTPYIREAGKLRKASW
GEALKAVAAAMKGRKVAGLVGDLAPVEAAFSLKMLIEGMGGRVECRTDGARLPAGNRSAY
VGNAAIEDIDNAKSILLVGCNPRDEAPVLNARIRKAWLQGAQVSVIGPAVDLTFDYHHAG
TDRAALMSLVSEAERSGADDKPGLVIVGQGALAEADGEAVLAQAMKLAQTMGAKLLVLHT
AAARVGAMDVGAVTEGGLSAAIEGAEVIYNLGADEVEIGAGPFVIYQGSHGDRGAHRADV
ILPAAAYTEENGLFVNTEGRPQLAFRAGFPPGEAKENWAILRALSAELGQTLPWDTMAGL
RRKLVETVPHLGRIDQLTESEWQPLPLRDPATADFRLAVRDFYLTNPIARASQLMAELSA
MASRRGQPSLAAE
Download sequence
Identical sequences A3PIX6
WP_011840854.1.46944 349101.Rsph17029_1182 gi|126461950|ref|YP_001043064.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]