SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126462292|ref|YP_001043406.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126462292|ref|YP_001043406.1|
Domain Number 1 Region: 85-152
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.79e-33
Family CO dehydrogenase ISP C-domain like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126462292|ref|YP_001043406.1|
Sequence length 160
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
Sequence
MKVTMTVNGRPMSAETEGRTLLSSFLRDGLGLTGTHVGCDTTQCGACTVHVDGEPVKSCT
VLAQDVAGRSVTTIEGMANKDGSLSVIQQAFQDHHGLQCGFCTPGMVMISAALLNEKPNP
TEEEVRHYLKGNICRCTGYHNIVKAVMAAAGADSRKLAAE
Download sequence
Identical sequences A0A239CED8 A3PJW8
WP_011841077.1.39940 WP_011841077.1.46944 gi|126462292|ref|YP_001043406.1| 349101.Rsph17029_1524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]