SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126462758|ref|YP_001043872.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126462758|ref|YP_001043872.1|
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.8e-32
Family 2Fe-2S ferredoxin-related 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126462758|ref|YP_001043872.1|
Sequence length 107
Comment ferredoxin [Rhodobacter sphaeroides ATCC 17029]
Sequence
MAKITYVEFNGTEHVIDVAAGLTVMEGARDNGVPGIEADCGGACACSTCHVYVDPAWTDK
LPKKEAMEEDMLDFAWQPDPARSRLTCQIKVSDALDGLKVFIPEKQI
Download sequence
Identical sequences A0A239K2U6 A3PL84 B9KK94 Q3J107
gi|77463924|ref|YP_353428.1| WP_002720517.1.19875 WP_002720517.1.22285 WP_002720517.1.22689 WP_002720517.1.29994 WP_002720517.1.39940 WP_002720517.1.46944 WP_002720517.1.62547 WP_002720517.1.80699 WP_002720517.1.8565 YP_353428.1.90827 gi|221639780|ref|YP_002526042.1| 272943.RSP_0352 349101.Rsph17029_1996 557760.RSKD131_1681 gi|126462758|ref|YP_001043872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]