SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126463501|ref|YP_001044615.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126463501|ref|YP_001044615.1|
Domain Number 1 Region: 252-774
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 5.5e-189
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000219
Further Details:      
 
Domain Number 2 Region: 791-933
Classification Level Classification E-value
Superfamily ADC-like 8.59e-40
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0023
Further Details:      
 
Domain Number 3 Region: 96-248
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.28e-38
Family Ferredoxin domains from multidomain proteins 0.0061
Further Details:      
 
Domain Number 4 Region: 22-95
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.28e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126463501|ref|YP_001044615.1|
Sequence length 960
Comment formate dehydrogenase subunit alpha [Rhodobacter sphaeroides ATCC 17029]
Sequence
MKDFILPDDRDFGTPRSRATETVTLEIDGFPVTVPAGTSVMRAAAEAGISVPKLCASDTL
DAFGSCRLCLVEIEGRAGTPASCTTPVTPGMKVRTQTPKLKQLRRGVMELYISDHPLDCL
TCAANGDCELQDMAGAVGLRDVRYEAVENHFTPRNAGGDLNPQWMVKDESNPYFTYDPSK
CIVCSRCVRACEEVQGTFALTIEGRGFDSRVSAGMASDSFLTSDCVSCGACVQACPTATL
QEKSVIEIGTPERAVVTTCAYCGVGCSFKAEMRGDELVRMVPYKGGKANHGHSCVKGRFA
YGYAAHKDRILKPMVRESIHDPWQEVSWDEALGFAARRLTAIQEKHGRQSVGVITSSRCT
NEETYLVQKLTRAVFRNNNTDTCARVCHSPTGYGLGQTFGTSAGTQDFDSVEAADVVMVI
GANPTDGHPVFASRLKKRLRKGAKLIVVDPRRIDLVKSPHIAAAHHLALRPGTNVAVVTA
MAHVIVTEGLADEKFIRERCDWDEFQDFAEFAADPRHAPEAIESLTGVPAAELRAAARLY
ATGGNAAIYYGLGVTEHSQGSTTVIGIANLAMLTGNIGRPGVGVNPLRGQNNVQGSCDMG
SFPHELPGYRHVKSDAARAVFERLWGVEIDPEPGLRIPNMLDAAVEGTFKGLYCQGEDIL
QSDPDTRHVAAGLAAMECVIVHDLFLNETANYAHVFLPGSSFLEKDGTFTNAERRINRVR
KVMAPKNGFADWEVTQMLANALGAGWGYTHPSQIMDEIAATTPSFAGVSYERLEEAGSIQ
WPCNEEHPLGTPLMHVEGFVRGRGKLIRTEYVATDEKTGPRFPLLLTTGRILSQYNVGAQ
TRRTANSVWHPEDVLEIHPHDAEVRGVAEGDWVRLASRAGETTLRARLTDRVSPGVVYTT
FHHPATQANVITTDFSDWATNCPEYKVTAVQVAPSNGPSDWQEDYRAQADLARRILPAAE
Download sequence
Identical sequences A3PNC7
WP_011841857.1.46944 gi|126463501|ref|YP_001044615.1| 349101.Rsph17029_2741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]