SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126463992|ref|YP_001045105.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126463992|ref|YP_001045105.1|
Domain Number 1 Region: 203-365
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.65e-56
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00000265
Further Details:      
 
Domain Number 2 Region: 371-476
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 6.67e-33
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000148
Further Details:      
 
Domain Number 3 Region: 90-161
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 7.07e-29
Family CO dehydrogenase ISP C-domain like 0.0000305
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.36e-21
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126463992|ref|YP_001045105.1|
Sequence length 485
Comment molybdopterin dehydrogenase [Rhodobacter sphaeroides ATCC 17029]
Sequence
MTEIAFILNGTPLSVAAEPTRTLLDFLREDRGLTGTKEGCNEGDCGACTVMVTDETGPRA
LNACLLFLPQLQGKEVRTVEGLAAPDGRLHPVQQALIDHHGSQCGFCTPGFVMSMAAAHA
TGCRDHDDTLAGNLCRCTGYAPIVRAARAAEEAPPPDWLPSFTLPQISSGGTVSGESPSP
GGAAANARPAGGPGGADSPPAAGCRPTSLEEFARLYEAHPEATLIAGATDVGLWVTKDLR
DLPMPLFLGAIPELRRIEEAAGSLRVGAMVTISDLRAALAPRLPGLADLLRRFASVQIRN
AATLGGNIANGSPIGDTPPALIALGATLHLRRGETRRDLPLEEFFLDYRKQDRRPGEFVE
AVTIPTEAPGLRCYKLSKRFDQDISAVCGCFNISVEAGRVAAARLAFGGMAGIPKRAAAV
EAALLGRPWTLATIEAARPAFAEDFTPLSDMRASAGYRLEAAAALLVRAFHDLQGRPVSV
LEVEA
Download sequence
Identical sequences A3PPR7
gi|126463992|ref|YP_001045105.1| 349101.Rsph17029_3237 WP_011842202.1.46944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]