SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126464639|ref|YP_001045752.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126464639|ref|YP_001045752.1|
Domain Number 1 Region: 72-150
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.22e-30
Family CO dehydrogenase ISP C-domain like 0.00056
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.06e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126464639|ref|YP_001045752.1|
Sequence length 152
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
Sequence
MIHLTVNGREMSLDVDPDTPLLWVLRDELRLTGTKFGCGVAQCGACTVMLDGMPRRSCVT
PVGMIENASVTTIEGMEGPEISAVQAAWAASDVPQCGWCQSGQVMSATALLRQIPKPTDE
EIDHAMGGNLCRCATYVRIRQAIHDAARTLEG
Download sequence
Identical sequences A3PRL4 B9KWJ5 Q3IXF4
gi|77465178|ref|YP_354681.1| 272943.RSP_3164 349101.Rsph17029_3902 557760.RSKD131_3339 gi|126464639|ref|YP_001045752.1| WP_009561349.1.19875 WP_009561349.1.22285 WP_009561349.1.22689 WP_009561349.1.46944 WP_009561349.1.62547 WP_009561349.1.80699 WP_009561349.1.8565 YP_354681.1.90827 gi|221369176|ref|YP_002520272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]