SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126464680|ref|YP_001045793.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126464680|ref|YP_001045793.1|
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.36e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00097
Further Details:      
 
Domain Number 2 Region: 84-166
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 5.76e-25
Family CO dehydrogenase ISP C-domain like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126464680|ref|YP_001045793.1|
Sequence length 173
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
Sequence
MKTTLTINGEQREIEAEARVTLLDALRHDVGLTGTKKGCDHGQCGACTVIVDGRRINSCL
TLLCTQEGAEVTTIEGLGEPGRLSALQEAFLAQDGFQCGYCTPGQICSATAMIEEAAKGW
PSWVSEDLEGEAVLSREEISERMSGNLCRCACYPNIVEAIAKVADARMAEAAE
Download sequence
Identical sequences A0A239IA30 A3PRQ5
349101.Rsph17029_3943 WP_011842761.1.39940 WP_011842761.1.46944 gi|126464680|ref|YP_001045793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]