SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126464718|ref|YP_001045831.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126464718|ref|YP_001045831.1|
Domain Number 1 Region: 5-315
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.62e-59
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000285
Further Details:      
 
Domain Number 2 Region: 419-516
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 8.37e-39
Family D-aminopeptidase, middle and C-terminal domains 0.0000561
Further Details:      
 
Domain Number 3 Region: 333-413
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 7.32e-31
Family D-aminopeptidase, middle and C-terminal domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126464718|ref|YP_001045831.1|
Sequence length 516
Comment D-aminopeptidase [Rhodobacter sphaeroides ATCC 17029]
Sequence
MTLDLDALDRALDALPNLFRGPGGVAGVVKDGQVVASRAWGYADLTRRRPMETGTRLPIC
SISKQFTCGVLLDTLGDTAAYDARVAEFLPQFEGPLPTLRQLCDNQSGLRDYWALTVLQG
AEATQTFRREDALPLIARMKTGHFPPGTAYSYCNCNFRIVSEILESETGRALPDLYAERI
FGPAGMRTAELTSDTRHPADEVVGYEGSDAVGFFPADNGIFWIGDAGISASLQDMLAYES
WIDATRDDENSIYRRISVPPAYVCGTPASYGFGLSHETVAGLKVTGHGGALRGFRAQRFH
AADERLSVVVIFNHEASAHAAASSLLAAALGHEAPKGAGPEGWAGQWLDPESGLLLRVGE
DAEGLTLRFATGPDRLTVGEDGVPRGAGVSLAREGATLVMNRTSDNLTVRAEPLPVVAVA
DAGEIAGRYHARELEADLVIEARDGGAYAGFEGLLGAGPMERLHPVGPDVWIVTTRRSMD
APAPGDWTLQVRREGGAVAGLRLGCWLARRIDYARV
Download sequence
Identical sequences A3PRU3
gi|126464718|ref|YP_001045831.1| WP_011842788.1.46944 349101.Rsph17029_3981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]