SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126464064|ref|YP_001045177.1| from Rhodobacter sphaeroides ATCC 17029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126464064|ref|YP_001045177.1|
Domain Number 1 Region: 13-91
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000139
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126464064|ref|YP_001045177.1|
Sequence length 97
Comment chromosomal replication initiator DnaA domain-containing protein [Rhodobacter sphaeroides ATCC 17029]
Sequence
MTPEDAARAAEIRARGYPARITEIIAEVAEATGWEPQEITGARVFPGLVQARDLACFIAR
REGFSLTQIGNVLRRDHSSIKTALQREQRRRGGANAT
Download sequence
Identical sequences A3PPY9
gi|126464064|ref|YP_001045177.1| 349101.Rsph17029_3309 WP_011842255.1.46944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]