SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126434932|ref|YP_001070623.1| from Mycobacterium sp. JLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126434932|ref|YP_001070623.1|
Domain Number 1 Region: 112-290,414-583
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.41e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000934
Further Details:      
 
Domain Number 2 Region: 287-409
Classification Level Classification E-value
Superfamily GAD domain-like 6.98e-34
Family GAD domain 0.00046
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.67e-28
Family Anticodon-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126434932|ref|YP_001070623.1|
Sequence length 590
Comment aspartyl-tRNA synthetase [Mycobacterium sp. JLS]
Sequence
MLRSHAAGSLRPADAGQNVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGAVLEAAH
RLRAEFCVAVEGVVEVRPEGNENPEIPTGGIEVNATSLTVLGESAPLPFQLDDEAGEEAR
LKYRYLDLRREGPGKALRLRSKVNAAAREVLARHDFVEIETPTMTRSTPEGARDFLVPAR
LQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDA
DDVIAVSEEILKALWALIGHDLPTPLPRITYAEAMRRFGTDKPDLRFGLELVECKEFFAD
TTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGAKGLAYVLVGDDGTLGGPVAKN
LTDAERDGLAAHVGANPGDCIFFAAGPPKSSRALLGAARIEIAKRLDMIDPDAWAFTWVV
DWPLFEMAEDATAAGDVAVGSGAWTAVHHAFTAPQPQSEATFDTDPAGALADAYDIVCNG
NEIGGGSIRIHRRDVQERVFAMMGIEHDEAQEKFGFLLDAFTFGAPPHGGIAFGWDRITA
LLARMDSIREVIAFPKSGGGADPLTGAPAPITPQQRRESGIDAKPKKDGE
Download sequence
Identical sequences A0A1X0GZP5 A3PZ05
164757.Mjls_2347 WP_011855515.1.3374 WP_011855515.1.44017 gi|126434932|ref|YP_001070623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]