SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126436439|ref|YP_001072130.1| from Mycobacterium sp. JLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126436439|ref|YP_001072130.1|
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.44e-77
Family ATP synthase (F1-ATPase), gamma subunit 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126436439|ref|YP_001072130.1|
Sequence length 309
Comment F0F1 ATP synthase subunit gamma [Mycobacterium sp. JLS]
Sequence
MAATLRELRGRIRSAGSIKKITKAQEMIATSRIAKAQARVEAARPYDREITNMLTELATA
SALDHPLLVQRENPRRAGVLVVSSDRGLAGAYNANVFRRSEELFSLLREEGKEPVLYVVG
RKALSYYSFRNWDVTESWSGFSERPEYEHAQEIGETLVKAFMAGVDDEGDDAGADGILGL
DELHIVFTEFRSMLSQSAIARRIAPMVVEYSEEDTNEPHTLFSFEPSAETLFDALLPRYV
STRIFAAMLEAAASESASRRRAMKSASDNADDLIKDLTLMANRERQSQITQEISEIVGGA
NALADAAKK
Download sequence
Identical sequences A0A1A0UQC9 A0A1X0GKC4 A1UJY5 A3Q3B2 Q1B552
WP_011561257.1.20321 WP_011561257.1.3374 WP_011561257.1.37251 WP_011561257.1.44017 WP_011561257.1.47369 WP_011561257.1.73225 gi|108800841|ref|YP_641038.1| 164756.Mmcs_3877 164757.Mjls_3863 189918.Mkms_3951 gi|126436439|ref|YP_001072130.1| gi|119869981|ref|YP_939933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]