SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126437785|ref|YP_001073476.1| from Mycobacterium sp. JLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126437785|ref|YP_001073476.1|
Domain Number 1 Region: 44-238
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.000000494
Family Heme-dependent catalases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126437785|ref|YP_001073476.1|
Sequence length 241
Comment hypothetical protein Mjls_5221 [Mycobacterium sp. JLS]
Sequence
MPCIAVVKPAHPVCARVRAGTRSGVNVSDLLALPVEVGAAVRRRRLFHPAGVLARGRIER
VAPPGQGLPIETGDVIGRVSKAVGLPGSVPDIAGLAWRMTKDSRPWDILLATTAINRFML
LPTTSWDNTTYSSLMPLRYEGGVWWVRAHLTTKLDGPGLSLDTVTDQLARGDLDFSVDQA
AGTGEFGPLARLTLSEVIPPDKDLSFDPTLNTAPGVSLAPGWLTDFRRAAYRRSREGRDA
Q
Download sequence
Identical sequences A0A1A0T7V9 A0A1X0GP47
164757.Mjls_5221 gi|126437785|ref|YP_001073476.1| WP_011857271.1.3374 WP_011857271.1.37251 WP_011857271.1.44017 WP_011857271.1.73225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]