SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126178381|ref|YP_001046346.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178381|ref|YP_001046346.1|
Domain Number 1 Region: 129-258
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.78e-27
Family MJ1460-like 0.02
Further Details:      
 
Domain Number 2 Region: 19-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.09e-16
Family Hypothetical protein PH1932 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126178381|ref|YP_001046346.1|
Sequence length 272
Comment 4-vinyl reductase, 4VR [Methanoculleus marisnigri JR1]
Sequence
MEQGTNSRGRPGRPKANLEIDLYSTPAGARAVENPVRRTILAALRERECTFEEIVSLAGR
AKSTVSVHLQDLAAAGVIGSRPDPEDSRRKIFFLTGDLVASVLPETRVADDLAAYAGMYR
PGSGDPFAFYRLAFRTIRVSLMQEGVLLDPLLTRAGEWLGEELYPAVAAPETGAFCANIA
RFWEEHRLGRIEVAETEPLVLLIYDCFECVDLPVTGKPACAFDSGILRALFSRHYGRPAE
AVETRCYSMGFDHCRFEIAVEGGGREECRTPE
Download sequence
Identical sequences A3CSL4
368407.Memar_0431 gi|126178381|ref|YP_001046346.1| WP_011843274.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]