SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126178684|ref|YP_001046649.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178684|ref|YP_001046649.1|
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily YutG-like 1.57e-28
Family YutG-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126178684|ref|YP_001046649.1|
Sequence length 147
Comment phosphatidylglycerophosphatase A [Methanoculleus marisnigri JR1]
Sequence
MFEIERRLEEKGIVRRDIVAAAMELYVPHGIEADEAARRLDAKIGKALEDPNISSLLLGA
LLLEDELYVKRKDSEIADDPVFLLSDEIIGMAIAEVIGGTYARFEFTRYDQKKPGILGKL
GPFLDDAVAGLIAGCTSRLYSESMGSM
Download sequence
Identical sequences A3CTG7
368407.Memar_0734 gi|126178684|ref|YP_001046649.1| WP_011843578.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]