SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126178940|ref|YP_001046905.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178940|ref|YP_001046905.1|
Domain Number 1 Region: 657-916
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.22e-103
Family BC ATP-binding domain-like 0.000000362
Further Details:      
 
Domain Number 2 Region: 126-395
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-102
Family BC ATP-binding domain-like 0.000000126
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.34e-43
Family BC N-terminal domain-like 0.00000976
Further Details:      
 
Domain Number 4 Region: 532-656
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.45e-41
Family BC N-terminal domain-like 0.0000149
Further Details:      
 
Domain Number 5 Region: 391-530
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 9.55e-37
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00024
Further Details:      
 
Domain Number 6 Region: 920-1054
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.62e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126178940|ref|YP_001046905.1|
Sequence length 1056
Comment carbamoyl phosphate synthase large subunit [Methanoculleus marisnigri JR1]
Sequence
MPKKSHIKKVLIIGSGPIQIGQAAEFDFSGSQACRALREEGVEVVLVNSNPATIQTDPDT
ADVIYIEPLKAELIAKIIAKEKPDGILSGMGGQTGLNMTAELAEMGALEGVEILGTPLEA
IYRGEDREQFRDLMNAIGEPVPRSMILEHMNQIDEAIREVGLPAIIRPAYTLGGSGGGVA
HTPEEMRRICELGLARSRIHQVLVEESVAGWKEIEFEVMRDAADTCIIVCGMENVDPMGI
HTGESVVVAPILTLRDDEFQTLRTAAIKIIRALDVQGGCNIQFAYKDGDYRIIEVNPRVS
RSSALASKATGYPIARVAAKIAIGLRLDEIMNTVTGVTPASFEPAIDYVVVKVPRWPFDK
FKSADRTLTTAMKSTGEVMAIGRTVEEAFKKALRSLDNDMQQHTNPSEIRMILTSPTDER
FGCLFDAFREGFTVREIAELTAITPFFLEKIKNIVDLERKLETDFEPEDVRVARRSGFSD
EDLLALTKKTAGEIEALGGTPTYKMVDTCAAEFPATTPYFYSTWEEGCELVRDSAKKVLI
LGSGPIRIGQGIEFDYCTVHAVMALREEEGIEVHIVNNNPETVSTDADTSDRLFFEPMQL
EDVMNILKKDDYYGVMVQFGGQNSVNLAVPLEAEIRRLDLPTKILGTSPDAMDAAEDRDR
FSRLLTRLEIPSPANSSAYSEEEAREMAGEIGYPVLVRPSYVLGGRAMELVHDEAELESY
IKEAVRVSRKHPVLIDSFLQNAVEIDVDAVSDGTDVLIGGIMEHIEWAGVHSGDSACVIP
PQSLTPSVIARVRDYTKKIALGLGVVGLINIQYAVRNDVVYVLEANPRASRTVPFVAKAT
GIALAKIAAKVMVGRKLADMGVAEPEIEHVAVKEVLLPFNKLPGVDTVLGPEMKSTGEVM
GIDYDFGRAYYKACTAADNTLPTTGNVFISVTDEQKEELLPVARKLRELGLSLYGTSGTV
DFLTQNGVEANLVRKVQEGSPNVIDAMRSGSIRLIINTPADKASRQDHIQIMRAAVDYGI
PYITTLQAARAAAMAIDAIKREEITIEPLGHYHGLM
Download sequence
Identical sequences A3CU73
gi|126178940|ref|YP_001046905.1| WP_011843834.1.74427 368407.Memar_0990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]