SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126179011|ref|YP_001046976.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126179011|ref|YP_001046976.1|
Domain Number 1 Region: 164-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.2e-65
Family Actin/HSP70 0.00000103
Further Details:      
 
Domain Number 2 Region: 357-514
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 2.35e-58
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000206
Further Details:      
 
Domain Number 3 Region: 5-161
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.44e-57
Family Actin/HSP70 0.00000439
Further Details:      
 
Domain Number 4 Region: 483-577
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000000196
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126179011|ref|YP_001046976.1|
Sequence length 609
Comment molecular chaperone DnaK [Methanoculleus marisnigri JR1]
Sequence
MVSEKVLGIDLGTTNSCMAIMEGGRATVIANAEGGRTTPSVVAFSKEGERLVGNVAKRQA
ITNPNRTVQSIKRRMGTNEKVTIGDKTYTPQEISAMILQKMKLDAEEYLGEKIAKAVITV
PAYFNDAQRQATKDAGTIAGLEVLRIINEPTASALAYGIDREGDSTVLVYDLGGGTFDVS
ILQLGDGVFEVKSTAGNNRLGGDDFDTRVVDYLADEFRKKEGIDLRNDPVAMQRLRDAAE
NAKIELSTVQKTNINLPYITTTESGPKFLDVDLTRAKFEQLIGDLVDSTLGPVKQALSDA
KLGADDIDHILLVGGSTRVPLVQETVKKVLKKEPDKGINPDECVALGAAIQAGVLTGETK
DVLLLDVTPLSLGIETLGGIATKLIERNTTIPTRKSQIFSTAADGQTSVEIHVMQGERAL
AKDNFTLGRFQLTGIPPAPRGIPQIEVTFDIDANGIVHVSAKDLGTGNEQSITIKPQDSR
PSEAEIQRMMDEAKKFEAEDQKNREEIEIRNTADTAIFTAERAMKDAGDSIEAADKEKIE
SAIADLKKALEGDDLEAIKQKMDALTEAVYALTTKMYQQAQAAAAQQQQTEGAAKKDDTV
VDADYEVKE
Download sequence
Identical sequences A3CUE4
gi|126179011|ref|YP_001046976.1| WP_011843905.1.74427 368407.Memar_1061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]