SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114047563|ref|YP_738113.1| from Shewanella sp. MR-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114047563|ref|YP_738113.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.09e-110
Family FMN-linked oxidoreductases 0.00000000588
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.53e-36
Family N-terminal domain of adrenodoxin reductase-like 0.000014
Further Details:      
 
Domain Number 3 Region: 462-520,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114047563|ref|YP_738113.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Shewanella sp. MR-7]
Sequence
MSFPHLLEPLDLGFTQLKNRVLMGSMHTGLEEEKGGFEKLAAFYKERALGGVGLIVTGGI
SPNLRGRLTPHACQLSFPWQVGKHRIVTQAVHEADGKICMQILHAGRYGYHPFSQAPSKI
KSPITPFTPSAMSSRQVRATIKDYASSAALAKRAGYDGVEVMGSEGYLINQFISSRTNTR
TDEWGGSFEKRAQFPIEIVNAIRAKVGNDFIIIFRLSMLDLVDNGSTWDEVVQLAKWLEH
AGVSIINTGIGWHEARVPTIATSVPRGAFAWVTEKLKKSVSVPLIATNRINTPEIGEQII
ASGQADMVSMARPFLADPEFVNKAAANTPELINTCIGCNQACLDHTFSLKRATCLVNPRA
CYETEINFLPTHNKKRIAVMGAGPAGMAFSVYAAMRGHEVALFEAKSEVGGQFNLARKIP
GKEEFNETIRYFLNQIKLHKIDLRLNTRLDAKVLESETFDEIVIASGVVPRELSLPGFDS
PKVVDYQQVLTGQATIGNKVALIGAGGIGFDMAHYLCESESSTLNPEKWLKQWGIDKQYQ
HAGGLAEPEVDNSEHRQVYLLQRKTSKMGQGLGKTTGWIHRLVLKQHDVKMKTGVSYDKF
DDAGLHIRVGEQTEVLAVDNVILCAGQESNRTLVDEMKATGIPVHLIGGVDVAAELDAKR
AIRQGAELAMRL
Download sequence
Identical sequences Q0HUZ9
60481.Shewmr7_2068 WP_011626224.1.64021 gi|114047563|ref|YP_738113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]