SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116621790|ref|YP_823946.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116621790|ref|YP_823946.1|
Domain Number 1 Region: 3-203
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.14e-38
Family Hypothetical protein TM0269 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116621790|ref|YP_823946.1|
Sequence length 387
Comment hypothetical protein Acid_2672 [Candidatus Solibacter usitatus Ellin6076]
Sequence
MIQLAELCPEVTVQESEYLRLLGYPRDHELEGRARELAQGARAWYARHGKPWIYAREAGS
LELDGASIHIDGAGFSSPRLGETLRAAAAHSAVLVAVSAGPELERESQKLWSEEKPDEYF
FLEMFGSAVVEQLTMLAGARLCAWAEGERMAVLPHYSPGYAEWNIAEQPRLLRVMQGEMP
GPIESLDSGALRPRKSLLAVFGVTRRTAGVRLLSDLVACQGCSLDNCQYRRAPYRAPLPP
HKVNVKALKRWAQERLVLKSLPDGTVEAAFRYEGTTCTNMGRPLAFDYRVLLGTCEEGYP
IREQHCAPASGDTGHMAMCRYLDQRDRLMAAIEQEKPLAGRPLHDVLSWTRPSCAAGCYC
DADAREHKWGLVLETIQYALAHREGRE
Download sequence
Identical sequences Q024B5
gi|116621790|ref|YP_823946.1| 234267.Acid_2672 WP_011684427.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]