SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116625452|ref|YP_827608.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116625452|ref|YP_827608.1|
Domain Number 1 Region: 191-374
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.96e-65
Family B3/B4 domain of PheRS, PheT 0.0000172
Further Details:      
 
Domain Number 2 Region: 458-648
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-23
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0011
Further Details:      
 
Domain Number 3 Region: 47-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.3e-18
Family Myf domain 0.0042
Further Details:      
 
Domain Number 4 Region: 671-761
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.00000000000000654
Family Anticodon-binding domain of PheRS 0.00078
Further Details:      
 
Domain Number 5 Region: 392-466
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000595
Family Domains B1 and B5 of PheRS-beta, PheT 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116625452|ref|YP_827608.1|
Sequence length 769
Comment phenylalanyl-tRNA synthetase subunit beta [Candidatus Solibacter usitatus Ellin6076]
Sequence
MKFSYNWIREFVPGLTQAAAPLERLITMKTAECEGIEEEGKLLTIARVARVETVEPIPDS
HNVKAVVDAGPLGRKTVVCGAPNCRPGILTAYAPIGRKVVSGVESDGMLASGAELGINKD
HDGIVELNAPLGEPIPGCEPDAAIEIDNKSITHRPDLWGHHGMAREVAAILGLPLTDHAK
LDLLPEGVPAIRVQIEDLALCPRYSALVFENVTVQPSPLWLQYRLTAIGLNPINNIVDMT
NFVMAELAQPMHAFDADLLKGDTIFVRPAKAGEYFVALNDEEYTLDPSNLVIADASGAIA
LAGVIGGKGSAIGDTTTRVVLESANFQASSVRKTSSAIKLRTDASMRFEKAQDPSNTVRG
LARAIELLREISPGIRLVGGVADQRREIPAPPPIELPLAWLQRKLGRAIEASEVRRILES
LAFGVSEPTPGVFSVTVPSWRATKDISIKDDLVEEVGRMIGYDSIAPQAPLVPASVPPGN
PSRRFQHDVRNLFVDNGFTEVYNYSFLSEASVRAFGFDSASMIRVTNPIASDQELMRSSL
LPGIWRNVTENAKHHESFRLFEIGLEIHRRDTGLPNEIPHLIAAYYDRQGDGQPGLFELK
RLARCLMPNAQTVPAAAREFEHTARAAEIQVAGQTVGRLFELHPKLVETGRAAILDLDLR
LVQSLTAGETRYTPIRRYPSSAFDLSVLAGLREQAGTLQAAIASFAGPLQESIQFVRQYV
GPPLADGVKSVSFRLTVGSPERTLSSEEITAVRNAIIEGMRAKGYELRV
Download sequence
Identical sequences Q01SP7
WP_011688049.1.46729 gi|116625452|ref|YP_827608.1| 234267.Acid_6397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]