SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116626155|ref|YP_828311.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116626155|ref|YP_828311.1|
Domain Number 1 Region: 11-380
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.23e-101
Family Homocysteine S-methyltransferase 0.00000136
Further Details:      
 
Domain Number 2 Region: 333-620
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.35e-69
Family Methylenetetrahydrofolate reductase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116626155|ref|YP_828311.1|
Sequence length 622
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Candidatus Solibacter usitatus Ellin6076]
Sequence
MNTTTSSRAQEFRDQLARRVIVADGAMGTMLYSRGVFINRCFDELNLSAADMVRQIHQEY
VKAGAEILETNTFGATRQRLGAFGFAEKLQAINHAGVRLAREAANGSAYVAGAVGPLNVR
IEPLGPTSFAEARAAFREQIDALLEAGVDLLIFETFGNLDELREAVYAGYDASRGEVPMI
AQVTIDDFGHLPGGTDTETFTREMNNWPVDVIGLNCSVGPKATLETVERMMEFATKPLSA
MPNAGLPMRVEGRNIYLCSPEYMSQYARRLLWAGVKVIGGCCGTTPDHIKLIRSETRSLQ
PLQKQLAVTVEEPKVKAQALQPVPVAEKSQVGAKLAAGKFVTFVEILPPRGVDATREIAG
AKLCAEHGIDAINVPDGPRASARMSAQVTCQLIQAQAGIEAVNHFCCRDRNILGIQSELL
GTHGAGVRNLICITGDPPRMGAYPDATAVFDVDAIGLVNIVRNLNHGLDIGGNPMGSQTA
LLIGVGANPGALNMDEEIRRFEWKVEAGAEYVVTQPVFDLDLLEAFLKRIEHVKIPVLCG
IWPLTSYRNAEFMVNELRVPVPEMFMERMRRVDNAEKAREEGVAIAREMVARVSKMVQGA
QLSAPFGRYQMAIDVADAIESR
Download sequence
Identical sequences Q01QP4
234267.Acid_7115 gi|116626155|ref|YP_828311.1| WP_011688745.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]