SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116626338|ref|YP_828494.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|116626338|ref|YP_828494.1|
Domain Number - Region: 15-91
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0549
Family Methionine synthase SAM-binding domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116626338|ref|YP_828494.1|
Sequence length 100
Comment hypothetical protein Acid_7298 [Candidatus Solibacter usitatus Ellin6076]
Sequence
MKEWGFAQNHPNEELAQLHLFSMKKQQANGEIEFTITVKEFITPKEPTMHFFAQADKETN
QLTASYRPCGWGKTMLEALAECVRAINRFPYEGEGLKARI
Download sequence
Identical sequences Q01Q61
234267.Acid_7298 WP_011688925.1.46729 gi|116626338|ref|YP_828494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]