SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116620082|ref|YP_822238.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116620082|ref|YP_822238.1|
Domain Number 1 Region: 152-381
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.99e-32
Family GpdQ-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116620082|ref|YP_822238.1|
Sequence length 382
Comment metallophosphoesterase [Candidatus Solibacter usitatus Ellin6076]
Sequence
MANYSLDLSLIVIFTLVQWRITVIILRALPFRGVRYGIFLFDAFAAFSYTFSLSELSALT
RVPSRMGSVLGAGSLAYFMAATSVLVIYYVLAFVRKQVRADVNPGRRQVLNVTGSALLAS
PFLAMGYGAFITRTDFRVKEIDIALAGLPEDLDGLRILQLSDIHLSAFLSDGELARVIDA
SLELRPQLAVITGDLISGRGDPLDACIRQLARVKADAGVLACMGNHERYSRVEGYTTRQS
ARVGIRFLRGEAQALRFGNATLNVAGLDFQSSRQRKTYLRGAERLILPGATNILLQHNPD
TFPEAARQGYNLLLAGHTHGGQVTVEILDQAINPARFFTPYVYGLYRAGNSAAYVTRGIG
TIGIPARLGAPPEISLLRLRKA
Download sequence
Identical sequences Q02AG9
234267.Acid_0954 WP_011682729.1.46729 gi|116620082|ref|YP_822238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]