SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116621126|ref|YP_823282.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116621126|ref|YP_823282.1|
Domain Number 1 Region: 35-298
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.28e-72
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116621126|ref|YP_823282.1|
Sequence length 303
Comment L-proline dehydrogenase [Candidatus Solibacter usitatus Ellin6076]
Sequence
MVRAFFLFLSRQKQLRRWMETSPVAQRLSKRFVAGETLEQALAVSRKLNKQGITVTLDHL
GESVTSLAEAREARDVYRRTLDAIHAGDIQGNVSLKLTQFGLDLSYEECLANVEQLVRRA
AELGSFVRVDMESSEYVDRTLDLVRTLHARHGAVGVVIQSYLYRSKDDIAKLCAEKIRVR
LCKGAYLEPASLAFPQKSDVDRSYVELTQKLLTYGVYPAIATHDEAMIGQTKQFVSSKGI
GRECFEFQMLYGIRADLQRQLVADGYRLRLYVPFGKAWYPYYMRRLAERPANVLFILRNL
FRT
Download sequence
Identical sequences Q026S2
gi|116621126|ref|YP_823282.1| WP_011683770.1.46729 234267.Acid_2007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]