SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116622661|ref|YP_824817.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116622661|ref|YP_824817.1|
Domain Number 1 Region: 99-349
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.04e-44
Family Purple acid phosphatase-like 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|116622661|ref|YP_824817.1|
Domain Number - Region: 18-88
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0111
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116622661|ref|YP_824817.1|
Sequence length 355
Comment metallophosphoesterase [Candidatus Solibacter usitatus Ellin6076]
Sequence
MNPIRVLCLIAAAVPLLYSAPKIVGGPFAVNVTSRGATVMWIVETEELSVRPVGEAAKIS
PSLHAEKTDLANLQPNTRYEYEVAGLKGSFKTAPNGAEPFTFIAYGDVRTRHDVHRRVIA
KILETGVPDLILQSGDLVENGHDSSQWPTFFDIERELLRQTAFFPSLGNHERASKDFYEF
FQNETGFYSFNWGNAHFAVINSDINSISTSKSLRDEFWERQKRWLEDDLAGAQKADYRFV
MAHHPPYTAVERRQGDNPHVTALVPMFEKYKVTAGIFGHDHNYQHYLKNGVHYIVTGGGG
APLYDVNKPDPAITQKVVSIENFVTVSVNGKVAKVKAISIDGKILDEFEFQSPVK
Download sequence
Identical sequences Q020V7
234267.Acid_3560 gi|116622661|ref|YP_824817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]