SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116626117|ref|YP_828273.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116626117|ref|YP_828273.1|
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.15e-53
Family PP-loop ATPase 0.00022
Further Details:      
 
Domain Number 2 Region: 336-432
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.94e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0098
Further Details:      
 
Domain Number 3 Region: 191-287
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000471
Family MesJ substrate recognition domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116626117|ref|YP_828273.1|
Sequence length 440
Comment tRNA(Ile)-lysidine synthetase [Candidatus Solibacter usitatus Ellin6076]
Sequence
MFASGARVAVGVSGGADSVCLLHALVELGGLKLSVLHVDHGLRGAESRADAEFVGELAAR
MGLPFCLREVTLGPGNVEQEGRRARLRFFHEQLAAGNCDRVALGHTRSDQAETVLFRFLR
GSGTAGLAGIRPVTAEGIVRPLIELERAEIEEYLRERQIPWREDATNAGEEFARNRIRHG
LLPQLAAEWNPALVETLAHTAEFARAEEAYWAGEIDRLSAESLTAGDGCVLIRTESLKAL
SLAVARRLVRRAIQMAKGDLRGVDFGHVERVVELASAPTGRGRTQVPGLDVRRSFEWLRL
GVPFTRKPYSLKPLVPGTTQIPGTRNGISLELIEKSETSVLPWNVYNTEMGCLDWKRLAG
SLELRNWRFGDQYQPMGLTGSEKIKTLFQLQRIPVWERAQWPVLTDGESIVWTRRFGPAA
GFAAGPESGVVLKLGEVTIR
Download sequence
Identical sequences Q01QT2
WP_011688708.1.46729 234267.Acid_7075 gi|116626117|ref|YP_828273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]