SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146338608|ref|YP_001203656.1| from Bradyrhizobium sp. ORS 278

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146338608|ref|YP_001203656.1|
Domain Number 1 Region: 400-440,480-540,588-805
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.03e-84
Family Acetamidase/Formamidase-like 0.0002
Further Details:      
 
Domain Number 2 Region: 290-343
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000215
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146338608|ref|YP_001203656.1|
Sequence length 808
Comment hypothetical protein BRADO1536 [Bradyrhizobium sp. ORS 278]
Sequence
MRRTLSITGPRPTVELIWHGGCFDVPNPGRAMSFRPFTSESYAQGERPEAWRDVLNAAGL
QPAAKSPFDDGHATASHRSAPGIALSRLSAGAQAVAAVPQVQEDLPIALLAIEDGAVLRC
GDTHRIIPSGHLILLPRTADWSLAFQRDLRAIVLSVTSAALHGRISGKLKFARPQVIAPS
GLADVVCRTIEATARTLDMLSEAEWSTVAQSLVDLLLTLAHQQAVPTSETGSSATQAAIL
HRICQAIERELDDAELTPTRVAQAEGISERYLQKLFEGAGDNFTHYVKERRLQRAWTDLS
NPAEAHHSISEIAYRYGFADSAHFSRSFRARFGLSPREFRQQKAEQAVTSAAPRGQRGWP
QDALAQQRGCQTQASLKSSTALPAPANDQDARQRHHHLAVSAERVHWGYFSRSLPPQLEI
ASGDTITVETLTQHASDDPELMIAGDDGALSVFGWSKTRKNVDRRGAGPMDASVFGRGAG
EGFGVHICTGPVAIKDAQPGDVLEVRILDIVPRLSRSPKHRGRVFGSSVAAWWGYHYNEL
IAAPAPREAVTIYEIFAGDPEPHARALYSYRWEPQTDPAGVVHATYDYPGVPVAPGSIKR
RHGVLDNIRIPLRPHFGVIAVAPREVDFVDSIPPSYFGGNLDNWRLGKGSTVYLPVAVPG
ALLSVGDPHATQGDGELGGTAIECSMTGTFQVILHKKTQLAGKPFADLTYPLIETETDWV
LTGFSHPNYLAEFGAQGQSEVYAKSSLDLAMKDAFRKMRRFLMHIKGLSEDEAVALMSAA
VDFGVTQVVDGNWGVHAILSKRLFEDAD
Download sequence
Identical sequences A4YNE3
gi|146338608|ref|YP_001203656.1| 114615.BRADO1536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]