SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146338609|ref|YP_001203657.1| from Bradyrhizobium sp. ORS 278

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146338609|ref|YP_001203657.1|
Domain Number 1 Region: 7-48,87-147,194-410
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.88e-79
Family Acetamidase/Formamidase-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146338609|ref|YP_001203657.1|
Sequence length 413
Comment hypothetical protein BRADO1537 [Bradyrhizobium sp. ORS 278]
Sequence
MKHHLLPVSNKTVHWGYFSKVVTPALTLRSGDRATIETLTHHANDDYERMIKDDPGAESV
FKWTKEHKAVARRGSGPTEGPFIRGSGEGIGVHLLTGPVAIEGAEPGDVLEVRILDIRPR
PSQCGCHAGKCFGSNAAANWGFHYHDLIEEPKPREVVTIFELDTAGEPFAKAVYNYVWTP
QTDPDGIVHPTIDYPGVPVDHTTIKKRENILPGIKVPARLHFGTMGLAPSEADYVSSIPP
SYTGGNIDDWRIGKGARMYYPVAVPGAYFSVGDPHAAQGDSELGGTAIETSLTGDFEFIL
HKKNDLGGTQLEGLTHPLLETSEAWSVYGFTYPNYLAELGANAQTEIANHSSLDRAMRDA
FRKLRRFLMTVHHLSEDEAISLMSVGADFGVTQVVDANWGVHGTIRKNVFRCD
Download sequence
Identical sequences A4YNE4
114615.BRADO1537 gi|146338609|ref|YP_001203657.1| WP_011924651.1.46373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]