SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146341165|ref|YP_001206213.1| from Bradyrhizobium sp. ORS 278

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146341165|ref|YP_001206213.1|
Domain Number 1 Region: 6-310
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.28e-89
Family Acetamidase/Formamidase-like 0.000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146341165|ref|YP_001206213.1|
Sequence length 313
Comment acetamidase/formamidase [Bradyrhizobium sp. ORS 278]
Sequence
MAHHHLHASPETCHWGFFESRLKPVLTIDSGDEVTIDSISGGPDVLPDASKFYIPPELLE
VHAKSERMVPGHILTGPIAVKGAEVGDVLEVDILDVQLRQDWGYNFIRPLAGTLPDDFHQ
TRLMNIPLDRERMVGRMPWGLELPLAPFFGVMGTAPPSAWGRITSLIPRAMGGNLDNKEL
GAGAKLYLPVFVPGALFSCGDGHGVQGDGEVCVTAIETALQGRFRLTVRKDLSFDYPRAE
TPTHYMTMAMDPDLDQCVVKALRDMIVLLGEKRNLSREDAYTLCSLAADLRVTQTVNGSK
GIHCVIAKSVVHG
Download sequence
Identical sequences A4YVR2
gi|146341165|ref|YP_001206213.1| WP_011927109.1.46373 114615.BRADO4237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]