SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119385654|ref|YP_916709.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119385654|ref|YP_916709.1|
Domain Number 1 Region: 96-230
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.23e-26
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.21e-18
Family GntR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119385654|ref|YP_916709.1|
Sequence length 257
Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MPSEVNKGAPAAETTARHIEDLILEGSLRPGDPLLPEREMALRLNVSRPTLRQGIRMLEE
RGLIVADPGGGRRVAPLATSITDPLIELMASRGEVVDDYLELRGTLEGMAASLAATRASD
VDRATLTRCMERIDLAHDEADFRDEAEADVDLHVAVYEASHNVVLLQIMRALSGMLRKGV
FHNREKLYARPEVRDVLRAQHRAIYDAIMVRDPEAAARAAQDHMTYTKRVRAEIIAAEAR
LEISLRRIEGGSLTARN
Download sequence
Identical sequences A1B669
318586.Pden_2929 WP_011749203.1.25907 WP_011749203.1.3707 WP_011749203.1.52749 gi|119385654|ref|YP_916709.1| 2005168847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]