SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119387717|ref|YP_918751.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119387717|ref|YP_918751.1|
Domain Number 1 Region: 35-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.45e-19
Family GntR-like transcriptional regulators 0.025
Further Details:      
 
Domain Number 2 Region: 105-239
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000314
Family GntR ligand-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119387717|ref|YP_918751.1|
Sequence length 254
Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MINRASSNPQTPTFGTHVDLARTFRTDPAEADGMQTLPEQLSARIMALIINGEFEPGQRL
QESALAERFEVSRGPIREALRILEREGLVTMASRRGASVTRLTAERLRDIFNVRAALMGI
CAEELAERRDPEVPSIMDEGTRRLLAANEAGDEEEFIAIVYQLSMYISEAAGNEIARSIL
FSLGRQTLPLTRRLFQDEAERLTWAGNWQAISEAIRAGDPVRARQAVRKLLADIRTGVLA
VHERLEEERRSAGS
Download sequence
Identical sequences A1BC11
gi|119387717|ref|YP_918751.1|NC_008688 WP_011751213.1.25907 WP_011751213.1.3707 WP_011751213.1.52749 gi|119387717|ref|YP_918751.1| 318586.Pden_4995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]