SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120403600|ref|YP_953429.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120403600|ref|YP_953429.1|
Domain Number 1 Region: 127-319,406-566
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.7e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000312
Further Details:      
 
Domain Number 2 Region: 297-419
Classification Level Classification E-value
Superfamily GAD domain-like 9.81e-34
Family GAD domain 0.00043
Further Details:      
 
Domain Number 3 Region: 13-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.89e-28
Family Anticodon-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120403600|ref|YP_953429.1|
Sequence length 601
Comment aspartyl-tRNA synthetase [Mycobacterium vanbaalenii PYR-1]
Sequence
MTIPREQEYFVLRTRTAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGTSQVVF
REGEVLTQAHRLRSEFCVAVTGVVEIRPEGNANPEIATGEVEVSATSLTVLGESAALPFQ
LDETAGEEARLKYRYLDLRREVPGNAIRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPE
GARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQ
LDMEMSFVDADDVIAVSEQILKAIWALIGYDLPLPLPRISHADAMRRFGSDKPDMRFGLE
LVECTDYFMDTPFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGED
GELGGPVAKNLSDAERDGLASHVGANPGDCVFFSAGSAKAARALLGATRIEVAKRLDLID
PSAWAFTWVVDWPLFEPADDATASGDVAVGSGAWTAAHHAFTAPKPESEATFDTDPGSAM
ADAYDIVCNGNEIGGGSIRIHRSDIQERVFAMMGIDHDEARDKFGFLLDAFTFGAPPHGG
IAFGWDRIVALLAGLDSIREVIAFPKSGGGVDPLTDAPAPITALQRKESGIDAKPEKLDK
A
Download sequence
Identical sequences A1T8C3
gi|120403600|ref|YP_953429.1| 350058.Mvan_2615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]