SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120403742|ref|YP_953571.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120403742|ref|YP_953571.1|
Domain Number 1 Region: 82-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000876
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120403742|ref|YP_953571.1|
Sequence length 144
Comment hypothetical protein Mvan_2758 [Mycobacterium vanbaalenii PYR-1]
Sequence
MPVSLIWLIAALALAGAEALTGDLFLLMLSGGALAAAGSSFLLNWPIWADGIVFLLVSVL
LLVGVRPALRRRLMSGRGLPEPAKALEGKSALVLDRVAIHEGQVKLDGEVWTARPYNEND
VFEPGDHVTVVHIDGATAVVAKIG
Download sequence
Identical sequences A1T8R5
350058.Mvan_2758 WP_011779973.1.45031 gi|120403742|ref|YP_953571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]