SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120404460|ref|YP_954289.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120404460|ref|YP_954289.1|
Domain Number 1 Region: 17-176
Classification Level Classification E-value
Superfamily PEBP-like 4.97e-48
Family Prokaryotic PEBP-like proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120404460|ref|YP_954289.1|
Sequence length 178
Comment PEBP family protein [Mycobacterium vanbaalenii PYR-1]
Sequence
MAFDYDPYSFLPALPNFTLTSQSFEDGQPWGKDQVSGIMGAGGSDISPQLSWSGFPEETR
SFAVTVFDPDAPTASGFWHWAVFNLPATVTDLPAGVGDGSASGFPGDAVTLANDAGLKRF
IGAAPPAGHGVHRYIVAVHAVGVEKLDVPADATPAYLGFNLFGHAIARALITGTYEQH
Download sequence
Identical sequences A1TAT3
WP_011780687.1.45031 350058.Mvan_3488 gi|120404460|ref|YP_954289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]