SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120405018|ref|YP_954847.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120405018|ref|YP_954847.1|
Domain Number 1 Region: 57-375
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 8.37e-40
Family Heme-dependent catalases 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120405018|ref|YP_954847.1|
Sequence length 388
Comment hypothetical protein Mvan_4064 [Mycobacterium vanbaalenii PYR-1]
Sequence
MNDGGTPTPSIGYLHYDEDLAAWPAAEDALIADMIEALRKNNEHQYDKSKKNRRLWRNGK
PHAVRDAHSKSCAILRGELTVRADLPVQYRQGMFAEPGRTYPVIARISTTSGAIRSDQVR
GVRGLGLKVLGVHSPSGRRASDRFSADANQDFVFVTEPVFLFRDAAHYAGAGMRTAKLLS
HLPDAGMMFLNRVLRGARRIATLAGRELPRNLRVFADPNYHVLGQTFYTAAPIRFGTYVA
KLSVSPASKAVTDLISTTIPRHDPEALANVVKDHFRSNGADYVVSAQLCTNTDDMPIEDA
TVEWSEADSPYQPVAVIHYPPQTAHSDALARFGDDELTFNSWRGIDEHRPLGSINRLKLR
VYEESSIFRHEANGAEYLEPADLSTFPE
Download sequence
Identical sequences A1TCE1
gi|120405018|ref|YP_954847.1| WP_011781220.1.45031 350058.Mvan_4064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]