SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120406439|ref|YP_956268.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120406439|ref|YP_956268.1|
Domain Number 1 Region: 3-477
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.27e-195
Family Heme-dependent catalases 0.000000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120406439|ref|YP_956268.1|
Sequence length 482
Comment catalase [Mycobacterium vanbaalenii PYR-1]
Sequence
MADKFTTTDAGAPIPSLEHSLTVGPDGPILLQDHYLIEQMANFNRERIPERQPHAKGGGA
FGQFEVTQDVSGYTKAAFLQPGAKTDMVARFSTVAGERGSPDTWRDPRGFALKFYTSEGN
FDMVGNNTPVFFMRDPMKFQNFIRSQKRMQATNLRDHHMQWDFWTLSPESAHQVTWLMGD
RGIPKTWRHMNGYSSHTYSWLNAADELFWVKYHIKTDQGVDFLTQEDADRLAGEDGDYHQ
RDLYTAIEDGNFPSWTLHVQIMPFEDAKTYRFNPFDLTKVWPHGDYPLHEVGRMTLNRNV
VDYHAQMEQAAFEPNNIVPGTGLSPDKMLLARGFSYSDAHRARLGVNYKQIPVNEPQVEV
NAYSKDGAMRIRNVTDPVYAPNSMGGPHADPRRASEVHWASDGDMVRQAYALRADDDDFG
QAGTLVREVLDDEARDRLAHNIIGHVSKGVREPVLSRVFEYWRNVDADLGKKVEEGVRNG
GG
Download sequence
Identical sequences A1TGG2
WP_011782617.1.45031 gi|120406439|ref|YP_956268.1| 350058.Mvan_5493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]