SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120406730|ref|YP_956559.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120406730|ref|YP_956559.1|
Domain Number 1 Region: 51-158
Classification Level Classification E-value
Superfamily Ferritin-like 0.0000269
Family Ferritin 0.009
Further Details:      
 
Weak hits

Sequence:  gi|120406730|ref|YP_956559.1|
Domain Number - Region: 212-303
Classification Level Classification E-value
Superfamily GAD domain-like 0.0785
Family GAD domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120406730|ref|YP_956559.1|
Sequence length 329
Comment hypothetical protein Mvan_5788 [Mycobacterium vanbaalenii PYR-1]
Sequence
MAAPTRTIESTESIKGTLIAQLRTVLDLTHTEIQVAETRVGQARTDAVRRELSQNAENAK
IRAEAIEKTIRELGGFPDVIGPFLGRAAAAVKALTEQAEPFDEALLGDLALEGQLLDRSR
YVKALAVAAKDQDVEALATRLITAHSATVDWLTTVLAEDALGGPAALRRTPMQAAAGLAV
KFANLPFTWSTRGAERVAEAIRSVRPAVADLIERGSRTGDVAAKALSGARDSALQTAERI
TREQGAEDAADLIHAARGATGILDPDELPISGYDELTVNDAANAVKDLTDPADIRTIVAY
EEAHKNRQRVVSAAQTRLAAIAQEVVGIN
Download sequence
Identical sequences A1THA3
WP_011782904.1.45031 WP_011782904.1.58012 gi|120406730|ref|YP_956559.1| 350058.Mvan_5788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]