SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120404185|ref|YP_954014.1| from Mycobacterium vanbaalenii PYR-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120404185|ref|YP_954014.1|
Domain Number 1 Region: 45-148
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 
Weak hits

Sequence:  gi|120404185|ref|YP_954014.1|
Domain Number - Region: 188-275
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0391
Family DNA gyrase/MutL, N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120404185|ref|YP_954014.1|
Sequence length 281
Comment anti-sigma-factor antagonist [Mycobacterium vanbaalenii PYR-1]
Sequence
MRRWPPKPRKHSPCCGSGSPSPSPRRARPTMVDRTHVHVSASRSLDGCAMLVLSGTLDSW
TYREVRNSVIKAALDEPKAVVVDVSDLHVPASSAWTAFTSARWHVSTWPDVPIVLVCAQE
ERRAAIQRSGASRWVPVHPDEASAAASIGEPHRLRRRARDELAADRSSLTRARGLVARWL
TEWACPDLILAASTVATVLIENVLEHTSSRPILVLEAFDGCVTVAVSDQCPTPAALHESS
GSGAHTVSGLAIVATLSRSWGSIPTANGKTVWTVLGPESRL
Download sequence
Identical sequences A1TA08
gi|120404185|ref|YP_954014.1| 350058.Mvan_3207 WP_011780413.1.45031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]