SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238892407|ref|YP_002917141.1| from Klebsiella pneumoniae NTUH-K2044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238892407|ref|YP_002917141.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.09e-40
Family Frataxin-like 0.000000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238892407|ref|YP_002917141.1|
Sequence length 106
Comment frataxin-like protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
Sequence
MNDSEFHRLADSLWMTIEERLDDWDGDSDIDCEINGGVLTISFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAASQQAGETVKFR
Download sequence
Identical sequences A0A0B7GGB2 A0A0E1CLB3 A0A0H3GPW0 A0A0J2G3V8 A0A1F2LSU9 A0A1V2SW49 A0A1Y0Q9Z2 A0A223UHP0 A0A2G8AC25 A6TGJ0 V0ASD3 W1AVE8 W1DJD0 W1EKU9 W1H6B0 W1HIW0 W1HXW2 W8UQ39 W9BJJ8
WP_002883389.1.100062 WP_002883389.1.100145 WP_002883389.1.100175 WP_002883389.1.100176 WP_002883389.1.100193 WP_002883389.1.100385 WP_002883389.1.100403 WP_002883389.1.100410 WP_002883389.1.100445 WP_002883389.1.100566 WP_002883389.1.100599 WP_002883389.1.10061 WP_002883389.1.100611 WP_002883389.1.100635 WP_002883389.1.100702 WP_002883389.1.100713 WP_002883389.1.100896 WP_002883389.1.10092 WP_002883389.1.100964 WP_002883389.1.100988 WP_002883389.1.10101 WP_002883389.1.10102 WP_002883389.1.101034 WP_002883389.1.101198 WP_002883389.1.101234 WP_002883389.1.101332 WP_002883389.1.101391 WP_002883389.1.101451 WP_002883389.1.101480 WP_002883389.1.101526 WP_002883389.1.101528 WP_002883389.1.101549 WP_002883389.1.101648 WP_002883389.1.101702 WP_002883389.1.101749 WP_002883389.1.101834 WP_002883389.1.101867 WP_002883389.1.101877 WP_002883389.1.101892 WP_002883389.1.10194 WP_002883389.1.101972 WP_002883389.1.10203 WP_002883389.1.102072 WP_002883389.1.102075 WP_002883389.1.102090 WP_002883389.1.10213 WP_002883389.1.102146 WP_002883389.1.10218 WP_002883389.1.10227 WP_002883389.1.10241 WP_002883389.1.10291 WP_002883389.1.10296 WP_002883389.1.10360 WP_002883389.1.10395 WP_002883389.1.10456 WP_002883389.1.10473 WP_002883389.1.10604 WP_002883389.1.1061 WP_002883389.1.10778 WP_002883389.1.10889 WP_002883389.1.10908 WP_002883389.1.11036 WP_002883389.1.11122 WP_002883389.1.11147 WP_002883389.1.11191 WP_002883389.1.11210 WP_002883389.1.11267 WP_002883389.1.11269 WP_002883389.1.11338 WP_002883389.1.11340 WP_002883389.1.11349 WP_002883389.1.11502 WP_002883389.1.11506 WP_002883389.1.11551 WP_002883389.1.11555 WP_002883389.1.11601 WP_002883389.1.11647 WP_002883389.1.11685 WP_002883389.1.11694 WP_002883389.1.11733 WP_002883389.1.11742 WP_002883389.1.11783 WP_002883389.1.11791 WP_002883389.1.11808 WP_002883389.1.11827 WP_002883389.1.11864 WP_002883389.1.1193 WP_002883389.1.11957 WP_002883389.1.11962 WP_002883389.1.11994 WP_002883389.1.12003 WP_002883389.1.12006 WP_002883389.1.12032 WP_002883389.1.12074 WP_002883389.1.12079 WP_002883389.1.12082 WP_002883389.1.12089 WP_002883389.1.12108 WP_002883389.1.12237 WP_002883389.1.12246 WP_002883389.1.1226 WP_002883389.1.12281 WP_002883389.1.12418 WP_002883389.1.12445 WP_002883389.1.1245 WP_002883389.1.12462 WP_002883389.1.12481 WP_002883389.1.12522 WP_002883389.1.12602 WP_002883389.1.12689 WP_002883389.1.12712 WP_002883389.1.12722 WP_002883389.1.12747 WP_002883389.1.12760 WP_002883389.1.12896 WP_002883389.1.12900 WP_002883389.1.1292 WP_002883389.1.12924 WP_002883389.1.12939 WP_002883389.1.1298 WP_002883389.1.12983 WP_002883389.1.13030 WP_002883389.1.13044 WP_002883389.1.13149 WP_002883389.1.13171 WP_002883389.1.13174 WP_002883389.1.13185 WP_002883389.1.13202 WP_002883389.1.1322 WP_002883389.1.13373 WP_002883389.1.13386 WP_002883389.1.13483 WP_002883389.1.13524 WP_002883389.1.13541 WP_002883389.1.13594 WP_002883389.1.13646 WP_002883389.1.13660 WP_002883389.1.13690 WP_002883389.1.13717 WP_002883389.1.13773 WP_002883389.1.13777 WP_002883389.1.13783 WP_002883389.1.13922 WP_002883389.1.14068 WP_002883389.1.14090 WP_002883389.1.14109 WP_002883389.1.14118 WP_002883389.1.14138 WP_002883389.1.14232 WP_002883389.1.14234 WP_002883389.1.14241 WP_002883389.1.14248 WP_002883389.1.14252 WP_002883389.1.14268 WP_002883389.1.14407 WP_002883389.1.1441 WP_002883389.1.14438 WP_002883389.1.14580 WP_002883389.1.14585 WP_002883389.1.14594 WP_002883389.1.14603 WP_002883389.1.14653 WP_002883389.1.14715 WP_002883389.1.14732 WP_002883389.1.14735 WP_002883389.1.1478 WP_002883389.1.14796 WP_002883389.1.14813 WP_002883389.1.14830 WP_002883389.1.14851 WP_002883389.1.14920 WP_002883389.1.14941 WP_002883389.1.14986 WP_002883389.1.14996 WP_002883389.1.1500 WP_002883389.1.15060 WP_002883389.1.15063 WP_002883389.1.15082 WP_002883389.1.1513 WP_002883389.1.15194 WP_002883389.1.15243 WP_002883389.1.15279 WP_002883389.1.15307 WP_002883389.1.1532 WP_002883389.1.15320 WP_002883389.1.15331 WP_002883389.1.15339 WP_002883389.1.15361 WP_002883389.1.15491 WP_002883389.1.15574 WP_002883389.1.15610 WP_002883389.1.15629 WP_002883389.1.15715 WP_002883389.1.1572 WP_002883389.1.15806 WP_002883389.1.15832 WP_002883389.1.15839 WP_002883389.1.15852 WP_002883389.1.15878 WP_002883389.1.15942 WP_002883389.1.1596 WP_002883389.1.15994 WP_002883389.1.160 WP_002883389.1.16054 WP_002883389.1.16128 WP_002883389.1.16196 WP_002883389.1.16289 WP_002883389.1.16299 WP_002883389.1.1631 WP_002883389.1.16314 WP_002883389.1.16326 WP_002883389.1.16348 WP_002883389.1.16380 WP_002883389.1.16505 WP_002883389.1.16515 WP_002883389.1.16536 WP_002883389.1.16559 WP_002883389.1.16659 WP_002883389.1.16738 WP_002883389.1.16758 WP_002883389.1.16830 WP_002883389.1.16877 WP_002883389.1.16917 WP_002883389.1.16928 WP_002883389.1.1702 WP_002883389.1.17053 WP_002883389.1.17211 WP_002883389.1.17236 WP_002883389.1.17326 WP_002883389.1.17342 WP_002883389.1.17508 WP_002883389.1.17587 WP_002883389.1.17661 WP_002883389.1.17736 WP_002883389.1.17761 WP_002883389.1.17768 WP_002883389.1.1782 WP_002883389.1.17921 WP_002883389.1.17926 WP_002883389.1.17930 WP_002883389.1.18096 WP_002883389.1.18148 WP_002883389.1.18150 WP_002883389.1.18171 WP_002883389.1.18176 WP_002883389.1.18217 WP_002883389.1.18227 WP_002883389.1.18241 WP_002883389.1.18284 WP_002883389.1.18296 WP_002883389.1.18351 WP_002883389.1.18378 WP_002883389.1.18409 WP_002883389.1.18431 WP_002883389.1.18434 WP_002883389.1.18443 WP_002883389.1.18552 WP_002883389.1.18599 WP_002883389.1.18664 WP_002883389.1.18682 WP_002883389.1.1869 WP_002883389.1.187 WP_002883389.1.18716 WP_002883389.1.18736 WP_002883389.1.18788 WP_002883389.1.18832 WP_002883389.1.18932 WP_002883389.1.18964 WP_002883389.1.18981 WP_002883389.1.19058 WP_002883389.1.19209 WP_002883389.1.19278 WP_002883389.1.19317 WP_002883389.1.19354 WP_002883389.1.1937 WP_002883389.1.19421 WP_002883389.1.19439 WP_002883389.1.19476 WP_002883389.1.19533 WP_002883389.1.19664 WP_002883389.1.19786 WP_002883389.1.1986 WP_002883389.1.19885 WP_002883389.1.19888 WP_002883389.1.19911 WP_002883389.1.19937 WP_002883389.1.19984 WP_002883389.1.19989 WP_002883389.1.2000 WP_002883389.1.20019 WP_002883389.1.20050 WP_002883389.1.20122 WP_002883389.1.20179 WP_002883389.1.20205 WP_002883389.1.20217 WP_002883389.1.2023 WP_002883389.1.20278 WP_002883389.1.2031 WP_002883389.1.20375 WP_002883389.1.2038 WP_002883389.1.20426 WP_002883389.1.2044 WP_002883389.1.2045 WP_002883389.1.20472 WP_002883389.1.20476 WP_002883389.1.205 WP_002883389.1.20528 WP_002883389.1.2055 WP_002883389.1.20621 WP_002883389.1.20639 WP_002883389.1.20647 WP_002883389.1.2068 WP_002883389.1.20685 WP_002883389.1.20750 WP_002883389.1.20780 WP_002883389.1.20811 WP_002883389.1.20823 WP_002883389.1.20902 WP_002883389.1.20991 WP_002883389.1.21023 WP_002883389.1.21088 WP_002883389.1.21128 WP_002883389.1.21228 WP_002883389.1.21323 WP_002883389.1.2150 WP_002883389.1.21587 WP_002883389.1.21772 WP_002883389.1.21791 WP_002883389.1.21813 WP_002883389.1.21831 WP_002883389.1.21851 WP_002883389.1.21854 WP_002883389.1.21892 WP_002883389.1.21913 WP_002883389.1.2193 WP_002883389.1.21936 WP_002883389.1.21953 WP_002883389.1.21968 WP_002883389.1.22001 WP_002883389.1.22044 WP_002883389.1.22072 WP_002883389.1.22101 WP_002883389.1.22129 WP_002883389.1.22184 WP_002883389.1.22191 WP_002883389.1.22215 WP_002883389.1.22398 WP_002883389.1.22405 WP_002883389.1.2243 WP_002883389.1.22447 WP_002883389.1.22471 WP_002883389.1.2249 WP_002883389.1.2252 WP_002883389.1.22520 WP_002883389.1.22534 WP_002883389.1.22555 WP_002883389.1.2258 WP_002883389.1.22607 WP_002883389.1.22648 WP_002883389.1.22698 WP_002883389.1.22712 WP_002883389.1.2272 WP_002883389.1.22828 WP_002883389.1.22836 WP_002883389.1.22910 WP_002883389.1.22929 WP_002883389.1.22956 WP_002883389.1.23071 WP_002883389.1.23085 WP_002883389.1.23112 WP_002883389.1.23144 WP_002883389.1.23145 WP_002883389.1.23348 WP_002883389.1.23437 WP_002883389.1.23454 WP_002883389.1.2346 WP_002883389.1.2347 WP_002883389.1.23473 WP_002883389.1.2350 WP_002883389.1.23528 WP_002883389.1.23543 WP_002883389.1.23560 WP_002883389.1.23562 WP_002883389.1.23564 WP_002883389.1.23607 WP_002883389.1.23609 WP_002883389.1.23614 WP_002883389.1.23627 WP_002883389.1.23672 WP_002883389.1.23673 WP_002883389.1.23758 WP_002883389.1.23759 WP_002883389.1.23868 WP_002883389.1.23921 WP_002883389.1.23981 WP_002883389.1.23982 WP_002883389.1.24027 WP_002883389.1.24036 WP_002883389.1.24055 WP_002883389.1.24074 WP_002883389.1.24095 WP_002883389.1.24103 WP_002883389.1.2414 WP_002883389.1.24166 WP_002883389.1.24209 WP_002883389.1.24211 WP_002883389.1.24267 WP_002883389.1.2432 WP_002883389.1.24342 WP_002883389.1.24353 WP_002883389.1.244 WP_002883389.1.2447 WP_002883389.1.24566 WP_002883389.1.24587 WP_002883389.1.24590 WP_002883389.1.24635 WP_002883389.1.24707 WP_002883389.1.24801 WP_002883389.1.24816 WP_002883389.1.24887 WP_002883389.1.24890 WP_002883389.1.24911 WP_002883389.1.24919 WP_002883389.1.24951 WP_002883389.1.25122 WP_002883389.1.2513 WP_002883389.1.25163 WP_002883389.1.25198 WP_002883389.1.25239 WP_002883389.1.25254 WP_002883389.1.25275 WP_002883389.1.25318 WP_002883389.1.2536 WP_002883389.1.25391 WP_002883389.1.25407 WP_002883389.1.25429 WP_002883389.1.25492 WP_002883389.1.25559 WP_002883389.1.25563 WP_002883389.1.25575 WP_002883389.1.25582 WP_002883389.1.25904 WP_002883389.1.25918 WP_002883389.1.25920 WP_002883389.1.25933 WP_002883389.1.25938 WP_002883389.1.25942 WP_002883389.1.25969 WP_002883389.1.25987 WP_002883389.1.26045 WP_002883389.1.26067 WP_002883389.1.26200 WP_002883389.1.26219 WP_002883389.1.26285 WP_002883389.1.26299 WP_002883389.1.26308 WP_002883389.1.26336 WP_002883389.1.26342 WP_002883389.1.26396 WP_002883389.1.26427 WP_002883389.1.26448 WP_002883389.1.26449 WP_002883389.1.26475 WP_002883389.1.26515 WP_002883389.1.26639 WP_002883389.1.26675 WP_002883389.1.26727 WP_002883389.1.26824 WP_002883389.1.2683 WP_002883389.1.26830 WP_002883389.1.26843 WP_002883389.1.2686 WP_002883389.1.26890 WP_002883389.1.26974 WP_002883389.1.27054 WP_002883389.1.27121 WP_002883389.1.27144 WP_002883389.1.2716 WP_002883389.1.27224 WP_002883389.1.27264 WP_002883389.1.27268 WP_002883389.1.27319 WP_002883389.1.27356 WP_002883389.1.27443 WP_002883389.1.27477 WP_002883389.1.27488 WP_002883389.1.27543 WP_002883389.1.27550 WP_002883389.1.27703 WP_002883389.1.27766 WP_002883389.1.27809 WP_002883389.1.27828 WP_002883389.1.27925 WP_002883389.1.27952 WP_002883389.1.2796 WP_002883389.1.27991 WP_002883389.1.28049 WP_002883389.1.28083 WP_002883389.1.28086 WP_002883389.1.28112 WP_002883389.1.28135 WP_002883389.1.2814 WP_002883389.1.28196 WP_002883389.1.28203 WP_002883389.1.28291 WP_002883389.1.28375 WP_002883389.1.28435 WP_002883389.1.28446 WP_002883389.1.28463 WP_002883389.1.28640 WP_002883389.1.28660 WP_002883389.1.2870 WP_002883389.1.28752 WP_002883389.1.28764 WP_002883389.1.28910 WP_002883389.1.28927 WP_002883389.1.28928 WP_002883389.1.28974 WP_002883389.1.28992 WP_002883389.1.29021 WP_002883389.1.29072 WP_002883389.1.29120 WP_002883389.1.29240 WP_002883389.1.29305 WP_002883389.1.29333 WP_002883389.1.29334 WP_002883389.1.29346 WP_002883389.1.29392 WP_002883389.1.29424 WP_002883389.1.29448 WP_002883389.1.29466 WP_002883389.1.29529 WP_002883389.1.29583 WP_002883389.1.29636 WP_002883389.1.29726 WP_002883389.1.29748 WP_002883389.1.29772 WP_002883389.1.29816 WP_002883389.1.29829 WP_002883389.1.29858 WP_002883389.1.2990 WP_002883389.1.29915 WP_002883389.1.29974 WP_002883389.1.2999 WP_002883389.1.30010 WP_002883389.1.30078 WP_002883389.1.30132 WP_002883389.1.30184 WP_002883389.1.30207 WP_002883389.1.30264 WP_002883389.1.30296 WP_002883389.1.30300 WP_002883389.1.30339 WP_002883389.1.30390 WP_002883389.1.30426 WP_002883389.1.30455 WP_002883389.1.30471 WP_002883389.1.30478 WP_002883389.1.30576 WP_002883389.1.30634 WP_002883389.1.30638 WP_002883389.1.30704 WP_002883389.1.3081 WP_002883389.1.30897 WP_002883389.1.30929 WP_002883389.1.3099 WP_002883389.1.31061 WP_002883389.1.31064 WP_002883389.1.3111 WP_002883389.1.313 WP_002883389.1.31374 WP_002883389.1.3138 WP_002883389.1.31459 WP_002883389.1.31536 WP_002883389.1.31556 WP_002883389.1.3159 WP_002883389.1.31591 WP_002883389.1.31601 WP_002883389.1.31630 WP_002883389.1.3164 WP_002883389.1.31846 WP_002883389.1.31890 WP_002883389.1.31906 WP_002883389.1.31920 WP_002883389.1.31938 WP_002883389.1.31948 WP_002883389.1.31992 WP_002883389.1.32013 WP_002883389.1.32023 WP_002883389.1.32057 WP_002883389.1.32211 WP_002883389.1.32212 WP_002883389.1.32300 WP_002883389.1.32315 WP_002883389.1.32336 WP_002883389.1.3234 WP_002883389.1.32354 WP_002883389.1.32369 WP_002883389.1.32371 WP_002883389.1.32612 WP_002883389.1.32690 WP_002883389.1.32788 WP_002883389.1.32809 WP_002883389.1.3282 WP_002883389.1.32827 WP_002883389.1.32849 WP_002883389.1.32854 WP_002883389.1.32857 WP_002883389.1.32915 WP_002883389.1.32936 WP_002883389.1.33041 WP_002883389.1.33057 WP_002883389.1.33136 WP_002883389.1.3317 WP_002883389.1.33229 WP_002883389.1.33399 WP_002883389.1.33435 WP_002883389.1.33446 WP_002883389.1.33481 WP_002883389.1.33498 WP_002883389.1.33539 WP_002883389.1.33544 WP_002883389.1.33583 WP_002883389.1.3361 WP_002883389.1.33642 WP_002883389.1.33660 WP_002883389.1.33704 WP_002883389.1.33750 WP_002883389.1.33755 WP_002883389.1.3378 WP_002883389.1.33806 WP_002883389.1.33831 WP_002883389.1.33836 WP_002883389.1.33838 WP_002883389.1.33889 WP_002883389.1.33942 WP_002883389.1.33943 WP_002883389.1.33985 WP_002883389.1.34110 WP_002883389.1.34113 WP_002883389.1.34114 WP_002883389.1.34173 WP_002883389.1.34213 WP_002883389.1.34258 WP_002883389.1.34265 WP_002883389.1.34311 WP_002883389.1.34316 WP_002883389.1.34367 WP_002883389.1.34390 WP_002883389.1.34439 WP_002883389.1.34479 WP_002883389.1.34481 WP_002883389.1.3450 WP_002883389.1.34507 WP_002883389.1.34636 WP_002883389.1.34654 WP_002883389.1.34678 WP_002883389.1.34681 WP_002883389.1.34696 WP_002883389.1.34706 WP_002883389.1.34748 WP_002883389.1.34757 WP_002883389.1.34826 WP_002883389.1.34850 WP_002883389.1.34853 WP_002883389.1.34869 WP_002883389.1.34885 WP_002883389.1.34910 WP_002883389.1.34955 WP_002883389.1.35028 WP_002883389.1.35033 WP_002883389.1.35109 WP_002883389.1.35197 WP_002883389.1.3525 WP_002883389.1.35268 WP_002883389.1.35284 WP_002883389.1.35286 WP_002883389.1.3529 WP_002883389.1.35453 WP_002883389.1.35496 WP_002883389.1.35568 WP_002883389.1.35574 WP_002883389.1.35626 WP_002883389.1.35645 WP_002883389.1.35699 WP_002883389.1.35731 WP_002883389.1.35786 WP_002883389.1.35793 WP_002883389.1.35814 WP_002883389.1.35820 WP_002883389.1.35850 WP_002883389.1.35863 WP_002883389.1.35914 WP_002883389.1.35918 WP_002883389.1.36018 WP_002883389.1.36025 WP_002883389.1.36029 WP_002883389.1.3605 WP_002883389.1.36080 WP_002883389.1.36084 WP_002883389.1.36092 WP_002883389.1.36099 WP_002883389.1.36130 WP_002883389.1.36151 WP_002883389.1.36237 WP_002883389.1.36306 WP_002883389.1.36383 WP_002883389.1.36388 WP_002883389.1.3640 WP_002883389.1.36402 WP_002883389.1.3644 WP_002883389.1.36451 WP_002883389.1.36468 WP_002883389.1.3657 WP_002883389.1.36728 WP_002883389.1.36825 WP_002883389.1.36849 WP_002883389.1.36998 WP_002883389.1.37066 WP_002883389.1.37140 WP_002883389.1.3716 WP_002883389.1.37171 WP_002883389.1.37177 WP_002883389.1.37207 WP_002883389.1.37225 WP_002883389.1.37235 WP_002883389.1.37238 WP_002883389.1.37264 WP_002883389.1.37279 WP_002883389.1.37356 WP_002883389.1.37361 WP_002883389.1.3738 WP_002883389.1.37391 WP_002883389.1.37438 WP_002883389.1.37456 WP_002883389.1.37565 WP_002883389.1.37614 WP_002883389.1.37617 WP_002883389.1.37681 WP_002883389.1.37716 WP_002883389.1.37753 WP_002883389.1.37829 WP_002883389.1.37860 WP_002883389.1.38008 WP_002883389.1.38089 WP_002883389.1.38094 WP_002883389.1.38179 WP_002883389.1.38215 WP_002883389.1.38231 WP_002883389.1.38236 WP_002883389.1.38269 WP_002883389.1.38399 WP_002883389.1.38433 WP_002883389.1.38448 WP_002883389.1.38464 WP_002883389.1.38593 WP_002883389.1.3862 WP_002883389.1.38700 WP_002883389.1.38705 WP_002883389.1.38729 WP_002883389.1.38737 WP_002883389.1.38815 WP_002883389.1.38838 WP_002883389.1.38849 WP_002883389.1.3888 WP_002883389.1.38912 WP_002883389.1.38921 WP_002883389.1.38970 WP_002883389.1.39101 WP_002883389.1.39149 WP_002883389.1.39169 WP_002883389.1.39299 WP_002883389.1.39360 WP_002883389.1.39418 WP_002883389.1.39439 WP_002883389.1.39456 WP_002883389.1.39482 WP_002883389.1.39498 WP_002883389.1.39532 WP_002883389.1.39534 WP_002883389.1.39637 WP_002883389.1.39677 WP_002883389.1.39698 WP_002883389.1.39705 WP_002883389.1.39815 WP_002883389.1.3982 WP_002883389.1.39852 WP_002883389.1.39878 WP_002883389.1.3988 WP_002883389.1.3992 WP_002883389.1.4 WP_002883389.1.40042 WP_002883389.1.40054 WP_002883389.1.40078 WP_002883389.1.40185 WP_002883389.1.40201 WP_002883389.1.40295 WP_002883389.1.4032 WP_002883389.1.40394 WP_002883389.1.40396 WP_002883389.1.40527 WP_002883389.1.40551 WP_002883389.1.40561 WP_002883389.1.40587 WP_002883389.1.40597 WP_002883389.1.40604 WP_002883389.1.40614 WP_002883389.1.4064 WP_002883389.1.40675 WP_002883389.1.4069 WP_002883389.1.4072 WP_002883389.1.40798 WP_002883389.1.40817 WP_002883389.1.40825 WP_002883389.1.40866 WP_002883389.1.40878 WP_002883389.1.40913 WP_002883389.1.4098 WP_002883389.1.41003 WP_002883389.1.41049 WP_002883389.1.41073 WP_002883389.1.41095 WP_002883389.1.41096 WP_002883389.1.41159 WP_002883389.1.41182 WP_002883389.1.41221 WP_002883389.1.41282 WP_002883389.1.41283 WP_002883389.1.41303 WP_002883389.1.4131 WP_002883389.1.41336 WP_002883389.1.41352 WP_002883389.1.41358 WP_002883389.1.414 WP_002883389.1.41405 WP_002883389.1.4154 WP_002883389.1.41630 WP_002883389.1.41642 WP_002883389.1.41669 WP_002883389.1.41702 WP_002883389.1.41765 WP_002883389.1.4177 WP_002883389.1.41794 WP_002883389.1.41833 WP_002883389.1.4186 WP_002883389.1.41872 WP_002883389.1.41895 WP_002883389.1.41907 WP_002883389.1.41924 WP_002883389.1.41928 WP_002883389.1.41930 WP_002883389.1.41992 WP_002883389.1.42054 WP_002883389.1.42067 WP_002883389.1.42079 WP_002883389.1.42264 WP_002883389.1.42280 WP_002883389.1.42281 WP_002883389.1.42297 WP_002883389.1.42299 WP_002883389.1.42306 WP_002883389.1.42338 WP_002883389.1.42464 WP_002883389.1.42476 WP_002883389.1.42518 WP_002883389.1.42578 WP_002883389.1.42583 WP_002883389.1.42584 WP_002883389.1.42629 WP_002883389.1.42635 WP_002883389.1.42724 WP_002883389.1.42755 WP_002883389.1.4286 WP_002883389.1.42881 WP_002883389.1.42951 WP_002883389.1.42953 WP_002883389.1.43010 WP_002883389.1.43043 WP_002883389.1.43050 WP_002883389.1.43084 WP_002883389.1.4312 WP_002883389.1.43146 WP_002883389.1.43214 WP_002883389.1.43221 WP_002883389.1.43228 WP_002883389.1.43231 WP_002883389.1.43233 WP_002883389.1.43386 WP_002883389.1.4346 WP_002883389.1.43492 WP_002883389.1.4351 WP_002883389.1.43538 WP_002883389.1.4359 WP_002883389.1.43611 WP_002883389.1.43833 WP_002883389.1.43836 WP_002883389.1.43853 WP_002883389.1.43874 WP_002883389.1.4393 WP_002883389.1.43941 WP_002883389.1.44117 WP_002883389.1.4414 WP_002883389.1.4416 WP_002883389.1.44239 WP_002883389.1.44267 WP_002883389.1.4430 WP_002883389.1.44325 WP_002883389.1.44368 WP_002883389.1.44418 WP_002883389.1.44528 WP_002883389.1.44567 WP_002883389.1.44708 WP_002883389.1.44805 WP_002883389.1.44896 WP_002883389.1.44931 WP_002883389.1.44946 WP_002883389.1.45107 WP_002883389.1.45137 WP_002883389.1.45191 WP_002883389.1.45258 WP_002883389.1.45319 WP_002883389.1.45327 WP_002883389.1.45380 WP_002883389.1.45395 WP_002883389.1.45443 WP_002883389.1.45445 WP_002883389.1.45482 WP_002883389.1.45519 WP_002883389.1.45520 WP_002883389.1.45557 WP_002883389.1.45592 WP_002883389.1.45594 WP_002883389.1.45644 WP_002883389.1.45821 WP_002883389.1.45910 WP_002883389.1.45911 WP_002883389.1.45970 WP_002883389.1.46 WP_002883389.1.46002 WP_002883389.1.46006 WP_002883389.1.46130 WP_002883389.1.46134 WP_002883389.1.46148 WP_002883389.1.46175 WP_002883389.1.46199 WP_002883389.1.46254 WP_002883389.1.46260 WP_002883389.1.46279 WP_002883389.1.46288 WP_002883389.1.46327 WP_002883389.1.46384 WP_002883389.1.46393 WP_002883389.1.46397 WP_002883389.1.4641 WP_002883389.1.46427 WP_002883389.1.46455 WP_002883389.1.4655 WP_002883389.1.46561 WP_002883389.1.46563 WP_002883389.1.4664 WP_002883389.1.46776 WP_002883389.1.46782 WP_002883389.1.46838 WP_002883389.1.46890 WP_002883389.1.46971 WP_002883389.1.46977 WP_002883389.1.46985 WP_002883389.1.47007 WP_002883389.1.47027 WP_002883389.1.47165 WP_002883389.1.47199 WP_002883389.1.472 WP_002883389.1.47252 WP_002883389.1.47264 WP_002883389.1.47302 WP_002883389.1.47354 WP_002883389.1.47371 WP_002883389.1.47376 WP_002883389.1.47378 WP_002883389.1.47379 WP_002883389.1.47413 WP_002883389.1.47461 WP_002883389.1.47521 WP_002883389.1.4760 WP_002883389.1.47623 WP_002883389.1.47641 WP_002883389.1.47661 WP_002883389.1.47716 WP_002883389.1.47760 WP_002883389.1.47777 WP_002883389.1.4779 WP_002883389.1.47815 WP_002883389.1.4787 WP_002883389.1.47871 WP_002883389.1.47885 WP_002883389.1.47887 WP_002883389.1.47919 WP_002883389.1.47922 WP_002883389.1.47982 WP_002883389.1.48022 WP_002883389.1.48110 WP_002883389.1.48228 WP_002883389.1.48237 WP_002883389.1.48255 WP_002883389.1.48274 WP_002883389.1.48362 WP_002883389.1.48402 WP_002883389.1.48442 WP_002883389.1.48496 WP_002883389.1.48514 WP_002883389.1.48539 WP_002883389.1.48587 WP_002883389.1.48606 WP_002883389.1.48609 WP_002883389.1.48673 WP_002883389.1.48686 WP_002883389.1.48793 WP_002883389.1.48850 WP_002883389.1.48871 WP_002883389.1.48893 WP_002883389.1.48900 WP_002883389.1.48972 WP_002883389.1.48975 WP_002883389.1.4900 WP_002883389.1.49006 WP_002883389.1.49035 WP_002883389.1.49052 WP_002883389.1.49069 WP_002883389.1.49133 WP_002883389.1.49151 WP_002883389.1.49157 WP_002883389.1.49194 WP_002883389.1.49209 WP_002883389.1.49307 WP_002883389.1.49333 WP_002883389.1.49394 WP_002883389.1.49424 WP_002883389.1.49438 WP_002883389.1.49480 WP_002883389.1.49568 WP_002883389.1.49579 WP_002883389.1.49589 WP_002883389.1.49613 WP_002883389.1.49695 WP_002883389.1.49721 WP_002883389.1.49762 WP_002883389.1.49809 WP_002883389.1.49817 WP_002883389.1.49829 WP_002883389.1.49834 WP_002883389.1.49877 WP_002883389.1.49887 WP_002883389.1.49897 WP_002883389.1.49933 WP_002883389.1.50018 WP_002883389.1.50022 WP_002883389.1.50029 WP_002883389.1.50049 WP_002883389.1.5011 WP_002883389.1.50133 WP_002883389.1.50165 WP_002883389.1.50195 WP_002883389.1.5023 WP_002883389.1.5026 WP_002883389.1.50283 WP_002883389.1.50321 WP_002883389.1.50335 WP_002883389.1.50364 WP_002883389.1.50429 WP_002883389.1.50434 WP_002883389.1.50465 WP_002883389.1.5054 WP_002883389.1.50541 WP_002883389.1.5057 WP_002883389.1.50619 WP_002883389.1.50672 WP_002883389.1.50693 WP_002883389.1.50730 WP_002883389.1.50823 WP_002883389.1.50831 WP_002883389.1.50866 WP_002883389.1.50910 WP_002883389.1.50927 WP_002883389.1.50992 WP_002883389.1.51016 WP_002883389.1.51090 WP_002883389.1.51105 WP_002883389.1.51132 WP_002883389.1.51135 WP_002883389.1.51176 WP_002883389.1.51181 WP_002883389.1.51311 WP_002883389.1.51312 WP_002883389.1.51343 WP_002883389.1.51347 WP_002883389.1.51372 WP_002883389.1.51390 WP_002883389.1.5140 WP_002883389.1.51401 WP_002883389.1.51413 WP_002883389.1.5143 WP_002883389.1.51438 WP_002883389.1.51448 WP_002883389.1.51479 WP_002883389.1.51560 WP_002883389.1.51561 WP_002883389.1.51563 WP_002883389.1.51599 WP_002883389.1.51614 WP_002883389.1.51670 WP_002883389.1.51688 WP_002883389.1.51698 WP_002883389.1.51779 WP_002883389.1.51791 WP_002883389.1.5181 WP_002883389.1.51885 WP_002883389.1.51907 WP_002883389.1.51922 WP_002883389.1.51965 WP_002883389.1.51975 WP_002883389.1.52012 WP_002883389.1.52021 WP_002883389.1.5205 WP_002883389.1.52051 WP_002883389.1.52054 WP_002883389.1.52079 WP_002883389.1.52215 WP_002883389.1.52275 WP_002883389.1.52288 WP_002883389.1.52309 WP_002883389.1.52368 WP_002883389.1.52477 WP_002883389.1.52534 WP_002883389.1.5259 WP_002883389.1.52609 WP_002883389.1.52635 WP_002883389.1.52686 WP_002883389.1.52703 WP_002883389.1.52813 WP_002883389.1.52920 WP_002883389.1.52927 WP_002883389.1.52929 WP_002883389.1.52954 WP_002883389.1.53015 WP_002883389.1.53061 WP_002883389.1.53122 WP_002883389.1.53187 WP_002883389.1.53359 WP_002883389.1.53388 WP_002883389.1.53391 WP_002883389.1.53402 WP_002883389.1.53461 WP_002883389.1.53484 WP_002883389.1.53568 WP_002883389.1.53585 WP_002883389.1.53588 WP_002883389.1.53597 WP_002883389.1.53656 WP_002883389.1.53716 WP_002883389.1.53717 WP_002883389.1.53727 WP_002883389.1.53734 WP_002883389.1.53736 WP_002883389.1.53817 WP_002883389.1.53834 WP_002883389.1.53897 WP_002883389.1.53937 WP_002883389.1.53990 WP_002883389.1.540 WP_002883389.1.54011 WP_002883389.1.54045 WP_002883389.1.5406 WP_002883389.1.54129 WP_002883389.1.54212 WP_002883389.1.54353 WP_002883389.1.54380 WP_002883389.1.54448 WP_002883389.1.54556 WP_002883389.1.54739 WP_002883389.1.54786 WP_002883389.1.548 WP_002883389.1.54824 WP_002883389.1.54952 WP_002883389.1.54959 WP_002883389.1.55032 WP_002883389.1.55048 WP_002883389.1.55050 WP_002883389.1.55086 WP_002883389.1.551 WP_002883389.1.55171 WP_002883389.1.55188 WP_002883389.1.55228 WP_002883389.1.5535 WP_002883389.1.55351 WP_002883389.1.55364 WP_002883389.1.55382 WP_002883389.1.55448 WP_002883389.1.55455 WP_002883389.1.55515 WP_002883389.1.55580 WP_002883389.1.55648 WP_002883389.1.55658 WP_002883389.1.55741 WP_002883389.1.5576 WP_002883389.1.55801 WP_002883389.1.55863 WP_002883389.1.55866 WP_002883389.1.55869 WP_002883389.1.55984 WP_002883389.1.56017 WP_002883389.1.56125 WP_002883389.1.56195 WP_002883389.1.5622 WP_002883389.1.56331 WP_002883389.1.5634 WP_002883389.1.56484 WP_002883389.1.56506 WP_002883389.1.56551 WP_002883389.1.56599 WP_002883389.1.56604 WP_002883389.1.56728 WP_002883389.1.568 WP_002883389.1.5682 WP_002883389.1.56847 WP_002883389.1.56897 WP_002883389.1.57112 WP_002883389.1.57139 WP_002883389.1.57239 WP_002883389.1.57310 WP_002883389.1.57325 WP_002883389.1.57365 WP_002883389.1.57398 WP_002883389.1.57421 WP_002883389.1.57455 WP_002883389.1.57475 WP_002883389.1.57497 WP_002883389.1.57501 WP_002883389.1.57618 WP_002883389.1.57630 WP_002883389.1.57643 WP_002883389.1.57648 WP_002883389.1.57662 WP_002883389.1.57702 WP_002883389.1.57704 WP_002883389.1.57716 WP_002883389.1.57747 WP_002883389.1.57877 WP_002883389.1.57886 WP_002883389.1.57914 WP_002883389.1.57940 WP_002883389.1.57993 WP_002883389.1.58028 WP_002883389.1.58091 WP_002883389.1.58118 WP_002883389.1.58134 WP_002883389.1.58176 WP_002883389.1.58224 WP_002883389.1.58230 WP_002883389.1.58280 WP_002883389.1.58300 WP_002883389.1.58307 WP_002883389.1.5831 WP_002883389.1.58399 WP_002883389.1.58426 WP_002883389.1.58466 WP_002883389.1.58479 WP_002883389.1.58533 WP_002883389.1.58579 WP_002883389.1.58594 WP_002883389.1.58631 WP_002883389.1.58685 WP_002883389.1.58720 WP_002883389.1.58752 WP_002883389.1.58771 WP_002883389.1.58865 WP_002883389.1.58873 WP_002883389.1.58914 WP_002883389.1.58967 WP_002883389.1.58980 WP_002883389.1.58985 WP_002883389.1.58994 WP_002883389.1.59015 WP_002883389.1.5903 WP_002883389.1.59042 WP_002883389.1.59069 WP_002883389.1.59074 WP_002883389.1.59115 WP_002883389.1.59172 WP_002883389.1.59222 WP_002883389.1.59485 WP_002883389.1.5951 WP_002883389.1.59518 WP_002883389.1.59557 WP_002883389.1.59559 WP_002883389.1.59600 WP_002883389.1.59620 WP_002883389.1.59661 WP_002883389.1.59705 WP_002883389.1.59708 WP_002883389.1.59729 WP_002883389.1.5975 WP_002883389.1.59796 WP_002883389.1.59840 WP_002883389.1.59865 WP_002883389.1.59873 WP_002883389.1.59924 WP_002883389.1.59936 WP_002883389.1.59972 WP_002883389.1.59993 WP_002883389.1.59996 WP_002883389.1.60020 WP_002883389.1.60038 WP_002883389.1.60060 WP_002883389.1.60074 WP_002883389.1.60266 WP_002883389.1.60276 WP_002883389.1.60336 WP_002883389.1.60372 WP_002883389.1.60416 WP_002883389.1.60511 WP_002883389.1.60534 WP_002883389.1.60564 WP_002883389.1.60587 WP_002883389.1.60611 WP_002883389.1.60627 WP_002883389.1.60681 WP_002883389.1.60745 WP_002883389.1.60830 WP_002883389.1.60843 WP_002883389.1.60861 WP_002883389.1.6089 WP_002883389.1.60905 WP_002883389.1.60922 WP_002883389.1.60964 WP_002883389.1.60972 WP_002883389.1.6099 WP_002883389.1.60995 WP_002883389.1.61061 WP_002883389.1.61079 WP_002883389.1.61178 WP_002883389.1.6122 WP_002883389.1.61272 WP_002883389.1.61416 WP_002883389.1.61556 WP_002883389.1.61572 WP_002883389.1.61640 WP_002883389.1.61775 WP_002883389.1.6180 WP_002883389.1.61812 WP_002883389.1.61898 WP_002883389.1.61940 WP_002883389.1.61973 WP_002883389.1.61994 WP_002883389.1.620 WP_002883389.1.62050 WP_002883389.1.62082 WP_002883389.1.62090 WP_002883389.1.62110 WP_002883389.1.62126 WP_002883389.1.62188 WP_002883389.1.62226 WP_002883389.1.62234 WP_002883389.1.62278 WP_002883389.1.62292 WP_002883389.1.62294 WP_002883389.1.62306 WP_002883389.1.62400 WP_002883389.1.62452 WP_002883389.1.62473 WP_002883389.1.62501 WP_002883389.1.62502 WP_002883389.1.62560 WP_002883389.1.62579 WP_002883389.1.62603 WP_002883389.1.6265 WP_002883389.1.62664 WP_002883389.1.62719 WP_002883389.1.62733 WP_002883389.1.62734 WP_002883389.1.62765 WP_002883389.1.62783 WP_002883389.1.62809 WP_002883389.1.6302 WP_002883389.1.63123 WP_002883389.1.63164 WP_002883389.1.63294 WP_002883389.1.63309 WP_002883389.1.63351 WP_002883389.1.63395 WP_002883389.1.63404 WP_002883389.1.6346 WP_002883389.1.6347 WP_002883389.1.63552 WP_002883389.1.63582 WP_002883389.1.63610 WP_002883389.1.63643 WP_002883389.1.63671 WP_002883389.1.63702 WP_002883389.1.63750 WP_002883389.1.63785 WP_002883389.1.6379 WP_002883389.1.63802 WP_002883389.1.6391 WP_002883389.1.63956 WP_002883389.1.63968 WP_002883389.1.63972 WP_002883389.1.64001 WP_002883389.1.6401 WP_002883389.1.64099 WP_002883389.1.64114 WP_002883389.1.64140 WP_002883389.1.64143 WP_002883389.1.64187 WP_002883389.1.64240 WP_002883389.1.6432 WP_002883389.1.64339 WP_002883389.1.64348 WP_002883389.1.6442 WP_002883389.1.64427 WP_002883389.1.64453 WP_002883389.1.64484 WP_002883389.1.64593 WP_002883389.1.64620 WP_002883389.1.64735 WP_002883389.1.6476 WP_002883389.1.64768 WP_002883389.1.64826 WP_002883389.1.64841 WP_002883389.1.64852 WP_002883389.1.64865 WP_002883389.1.64914 WP_002883389.1.64945 WP_002883389.1.65021 WP_002883389.1.65042 WP_002883389.1.65043 WP_002883389.1.65077 WP_002883389.1.65108 WP_002883389.1.65166 WP_002883389.1.65215 WP_002883389.1.6524 WP_002883389.1.65398 WP_002883389.1.65421 WP_002883389.1.65436 WP_002883389.1.65472 WP_002883389.1.65530 WP_002883389.1.65552 WP_002883389.1.65564 WP_002883389.1.65603 WP_002883389.1.65611 WP_002883389.1.65723 WP_002883389.1.65745 WP_002883389.1.65766 WP_002883389.1.65813 WP_002883389.1.65845 WP_002883389.1.6591 WP_002883389.1.660 WP_002883389.1.66019 WP_002883389.1.66020 WP_002883389.1.66047 WP_002883389.1.66070 WP_002883389.1.66080 WP_002883389.1.6610 WP_002883389.1.66108 WP_002883389.1.66117 WP_002883389.1.66152 WP_002883389.1.66236 WP_002883389.1.66271 WP_002883389.1.66294 WP_002883389.1.66339 WP_002883389.1.66409 WP_002883389.1.66415 WP_002883389.1.66430 WP_002883389.1.66434 WP_002883389.1.66481 WP_002883389.1.66529 WP_002883389.1.66547 WP_002883389.1.66555 WP_002883389.1.66568 WP_002883389.1.66577 WP_002883389.1.66597 WP_002883389.1.66613 WP_002883389.1.66670 WP_002883389.1.6670 WP_002883389.1.66714 WP_002883389.1.66740 WP_002883389.1.66753 WP_002883389.1.6678 WP_002883389.1.66839 WP_002883389.1.66857 WP_002883389.1.66895 WP_002883389.1.66896 WP_002883389.1.66930 WP_002883389.1.66947 WP_002883389.1.66989 WP_002883389.1.6715 WP_002883389.1.67313 WP_002883389.1.6737 WP_002883389.1.67399 WP_002883389.1.6742 WP_002883389.1.67492 WP_002883389.1.67512 WP_002883389.1.6754 WP_002883389.1.67591 WP_002883389.1.67765 WP_002883389.1.67766 WP_002883389.1.6779 WP_002883389.1.67855 WP_002883389.1.67858 WP_002883389.1.67916 WP_002883389.1.67929 WP_002883389.1.67936 WP_002883389.1.67946 WP_002883389.1.68090 WP_002883389.1.68173 WP_002883389.1.68189 WP_002883389.1.6823 WP_002883389.1.68403 WP_002883389.1.68491 WP_002883389.1.68507 WP_002883389.1.68511 WP_002883389.1.68519 WP_002883389.1.68533 WP_002883389.1.68543 WP_002883389.1.68659 WP_002883389.1.6868 WP_002883389.1.68768 WP_002883389.1.68844 WP_002883389.1.68848 WP_002883389.1.6885 WP_002883389.1.68940 WP_002883389.1.68946 WP_002883389.1.68986 WP_002883389.1.69002 WP_002883389.1.69027 WP_002883389.1.69028 WP_002883389.1.69062 WP_002883389.1.6912 WP_002883389.1.69153 WP_002883389.1.69212 WP_002883389.1.69268 WP_002883389.1.69384 WP_002883389.1.69453 WP_002883389.1.69459 WP_002883389.1.69576 WP_002883389.1.69595 WP_002883389.1.69613 WP_002883389.1.69635 WP_002883389.1.69637 WP_002883389.1.69719 WP_002883389.1.69738 WP_002883389.1.69744 WP_002883389.1.69745 WP_002883389.1.69753 WP_002883389.1.69814 WP_002883389.1.69836 WP_002883389.1.69861 WP_002883389.1.69915 WP_002883389.1.69947 WP_002883389.1.6997 WP_002883389.1.7000 WP_002883389.1.70009 WP_002883389.1.70050 WP_002883389.1.70101 WP_002883389.1.70112 WP_002883389.1.70140 WP_002883389.1.702 WP_002883389.1.70499 WP_002883389.1.70519 WP_002883389.1.70550 WP_002883389.1.70666 WP_002883389.1.70681 WP_002883389.1.70718 WP_002883389.1.7072 WP_002883389.1.70765 WP_002883389.1.70847 WP_002883389.1.70859 WP_002883389.1.70870 WP_002883389.1.70873 WP_002883389.1.70966 WP_002883389.1.7103 WP_002883389.1.71035 WP_002883389.1.71056 WP_002883389.1.71092 WP_002883389.1.71100 WP_002883389.1.71212 WP_002883389.1.71286 WP_002883389.1.71291 WP_002883389.1.71296 WP_002883389.1.7136 WP_002883389.1.71387 WP_002883389.1.71393 WP_002883389.1.71611 WP_002883389.1.71625 WP_002883389.1.71634 WP_002883389.1.7168 WP_002883389.1.71704 WP_002883389.1.71720 WP_002883389.1.71751 WP_002883389.1.71804 WP_002883389.1.7181 WP_002883389.1.71838 WP_002883389.1.71913 WP_002883389.1.72139 WP_002883389.1.72154 WP_002883389.1.72201 WP_002883389.1.72214 WP_002883389.1.7223 WP_002883389.1.72274 WP_002883389.1.72406 WP_002883389.1.72482 WP_002883389.1.72575 WP_002883389.1.72597 WP_002883389.1.72609 WP_002883389.1.72632 WP_002883389.1.72673 WP_002883389.1.72688 WP_002883389.1.72713 WP_002883389.1.7273 WP_002883389.1.72735 WP_002883389.1.72746 WP_002883389.1.72763 WP_002883389.1.72765 WP_002883389.1.72899 WP_002883389.1.73009 WP_002883389.1.73038 WP_002883389.1.7320 WP_002883389.1.73208 WP_002883389.1.73236 WP_002883389.1.73301 WP_002883389.1.73316 WP_002883389.1.73319 WP_002883389.1.73332 WP_002883389.1.73472 WP_002883389.1.73510 WP_002883389.1.73558 WP_002883389.1.73562 WP_002883389.1.73589 WP_002883389.1.73635 WP_002883389.1.73689 WP_002883389.1.73691 WP_002883389.1.73732 WP_002883389.1.73742 WP_002883389.1.73770 WP_002883389.1.73780 WP_002883389.1.73887 WP_002883389.1.73904 WP_002883389.1.73984 WP_002883389.1.74001 WP_002883389.1.74048 WP_002883389.1.74176 WP_002883389.1.74253 WP_002883389.1.74256 WP_002883389.1.74263 WP_002883389.1.74332 WP_002883389.1.74357 WP_002883389.1.74394 WP_002883389.1.74447 WP_002883389.1.74490 WP_002883389.1.7455 WP_002883389.1.74692 WP_002883389.1.747 WP_002883389.1.74715 WP_002883389.1.74732 WP_002883389.1.74759 WP_002883389.1.74788 WP_002883389.1.74817 WP_002883389.1.74839 WP_002883389.1.74847 WP_002883389.1.74905 WP_002883389.1.74909 WP_002883389.1.7493 WP_002883389.1.74981 WP_002883389.1.750 WP_002883389.1.75005 WP_002883389.1.75007 WP_002883389.1.75013 WP_002883389.1.75014 WP_002883389.1.75035 WP_002883389.1.7510 WP_002883389.1.75115 WP_002883389.1.75152 WP_002883389.1.75283 WP_002883389.1.75307 WP_002883389.1.75366 WP_002883389.1.75396 WP_002883389.1.75398 WP_002883389.1.75418 WP_002883389.1.75501 WP_002883389.1.75561 WP_002883389.1.75572 WP_002883389.1.75592 WP_002883389.1.75608 WP_002883389.1.75625 WP_002883389.1.75637 WP_002883389.1.75719 WP_002883389.1.7574 WP_002883389.1.75748 WP_002883389.1.7578 WP_002883389.1.75784 WP_002883389.1.75832 WP_002883389.1.75888 WP_002883389.1.75909 WP_002883389.1.75961 WP_002883389.1.75962 WP_002883389.1.76001 WP_002883389.1.76090 WP_002883389.1.76107 WP_002883389.1.76199 WP_002883389.1.7623 WP_002883389.1.76245 WP_002883389.1.76292 WP_002883389.1.76316 WP_002883389.1.76370 WP_002883389.1.76412 WP_002883389.1.76416 WP_002883389.1.7649 WP_002883389.1.76496 WP_002883389.1.76512 WP_002883389.1.76537 WP_002883389.1.76561 WP_002883389.1.76607 WP_002883389.1.76626 WP_002883389.1.76657 WP_002883389.1.76819 WP_002883389.1.76832 WP_002883389.1.76889 WP_002883389.1.76912 WP_002883389.1.76935 WP_002883389.1.76943 WP_002883389.1.76991 WP_002883389.1.77034 WP_002883389.1.77077 WP_002883389.1.77085 WP_002883389.1.77105 WP_002883389.1.77211 WP_002883389.1.7730 WP_002883389.1.77304 WP_002883389.1.77307 WP_002883389.1.77340 WP_002883389.1.77367 WP_002883389.1.77467 WP_002883389.1.77516 WP_002883389.1.77519 WP_002883389.1.77545 WP_002883389.1.77547 WP_002883389.1.77586 WP_002883389.1.77645 WP_002883389.1.77655 WP_002883389.1.777 WP_002883389.1.77723 WP_002883389.1.7773 WP_002883389.1.77799 WP_002883389.1.77800 WP_002883389.1.77802 WP_002883389.1.77875 WP_002883389.1.78001 WP_002883389.1.78012 WP_002883389.1.78062 WP_002883389.1.78065 WP_002883389.1.78103 WP_002883389.1.7811 WP_002883389.1.78119 WP_002883389.1.78171 WP_002883389.1.78214 WP_002883389.1.78260 WP_002883389.1.78268 WP_002883389.1.78290 WP_002883389.1.78334 WP_002883389.1.78350 WP_002883389.1.78354 WP_002883389.1.78387 WP_002883389.1.78417 WP_002883389.1.78418 WP_002883389.1.78421 WP_002883389.1.78472 WP_002883389.1.78533 WP_002883389.1.78534 WP_002883389.1.78540 WP_002883389.1.7858 WP_002883389.1.78591 WP_002883389.1.78597 WP_002883389.1.78725 WP_002883389.1.78745 WP_002883389.1.78772 WP_002883389.1.78861 WP_002883389.1.78922 WP_002883389.1.78950 WP_002883389.1.78962 WP_002883389.1.78981 WP_002883389.1.79021 WP_002883389.1.79091 WP_002883389.1.79108 WP_002883389.1.79109 WP_002883389.1.79141 WP_002883389.1.79175 WP_002883389.1.79211 WP_002883389.1.79236 WP_002883389.1.79266 WP_002883389.1.7935 WP_002883389.1.79420 WP_002883389.1.79520 WP_002883389.1.79541 WP_002883389.1.79582 WP_002883389.1.79599 WP_002883389.1.79608 WP_002883389.1.79625 WP_002883389.1.79636 WP_002883389.1.79756 WP_002883389.1.79857 WP_002883389.1.79868 WP_002883389.1.79935 WP_002883389.1.8001 WP_002883389.1.80027 WP_002883389.1.80047 WP_002883389.1.80051 WP_002883389.1.80062 WP_002883389.1.80217 WP_002883389.1.80227 WP_002883389.1.80355 WP_002883389.1.80362 WP_002883389.1.80466 WP_002883389.1.8054 WP_002883389.1.80554 WP_002883389.1.8056 WP_002883389.1.80615 WP_002883389.1.80692 WP_002883389.1.807 WP_002883389.1.80704 WP_002883389.1.80767 WP_002883389.1.80771 WP_002883389.1.80772 WP_002883389.1.80816 WP_002883389.1.80829 WP_002883389.1.81139 WP_002883389.1.81144 WP_002883389.1.81147 WP_002883389.1.81159 WP_002883389.1.81191 WP_002883389.1.81212 WP_002883389.1.81235 WP_002883389.1.81255 WP_002883389.1.81282 WP_002883389.1.81285 WP_002883389.1.81350 WP_002883389.1.81449 WP_002883389.1.81452 WP_002883389.1.81544 WP_002883389.1.81569 WP_002883389.1.81633 WP_002883389.1.81659 WP_002883389.1.81683 WP_002883389.1.81744 WP_002883389.1.81759 WP_002883389.1.81835 WP_002883389.1.81841 WP_002883389.1.81851 WP_002883389.1.81908 WP_002883389.1.82003 WP_002883389.1.82034 WP_002883389.1.82129 WP_002883389.1.82170 WP_002883389.1.82211 WP_002883389.1.82238 WP_002883389.1.82299 WP_002883389.1.82367 WP_002883389.1.82370 WP_002883389.1.82446 WP_002883389.1.82452 WP_002883389.1.8252 WP_002883389.1.82641 WP_002883389.1.82659 WP_002883389.1.82704 WP_002883389.1.82767 WP_002883389.1.82769 WP_002883389.1.82795 WP_002883389.1.82939 WP_002883389.1.8296 WP_002883389.1.82963 WP_002883389.1.83014 WP_002883389.1.83022 WP_002883389.1.83076 WP_002883389.1.83117 WP_002883389.1.8320 WP_002883389.1.83263 WP_002883389.1.83285 WP_002883389.1.83300 WP_002883389.1.83337 WP_002883389.1.83379 WP_002883389.1.83387 WP_002883389.1.83556 WP_002883389.1.8356 WP_002883389.1.83608 WP_002883389.1.83691 WP_002883389.1.83746 WP_002883389.1.83948 WP_002883389.1.84066 WP_002883389.1.84128 WP_002883389.1.84224 WP_002883389.1.84226 WP_002883389.1.84309 WP_002883389.1.84315 WP_002883389.1.84335 WP_002883389.1.84360 WP_002883389.1.84377 WP_002883389.1.84417 WP_002883389.1.8448 WP_002883389.1.84502 WP_002883389.1.84549 WP_002883389.1.84553 WP_002883389.1.84560 WP_002883389.1.8464 WP_002883389.1.84650 WP_002883389.1.84681 WP_002883389.1.84783 WP_002883389.1.84787 WP_002883389.1.84801 WP_002883389.1.84890 WP_002883389.1.84900 WP_002883389.1.85005 WP_002883389.1.85010 WP_002883389.1.85063 WP_002883389.1.85102 WP_002883389.1.85115 WP_002883389.1.85191 WP_002883389.1.85193 WP_002883389.1.85263 WP_002883389.1.85366 WP_002883389.1.85390 WP_002883389.1.85423 WP_002883389.1.85487 WP_002883389.1.8549 WP_002883389.1.85497 WP_002883389.1.85523 WP_002883389.1.85539 WP_002883389.1.85564 WP_002883389.1.85571 WP_002883389.1.85622 WP_002883389.1.85680 WP_002883389.1.85702 WP_002883389.1.85731 WP_002883389.1.85761 WP_002883389.1.85783 WP_002883389.1.85785 WP_002883389.1.85805 WP_002883389.1.85954 WP_002883389.1.85960 WP_002883389.1.85965 WP_002883389.1.85970 WP_002883389.1.85985 WP_002883389.1.86031 WP_002883389.1.86039 WP_002883389.1.86074 WP_002883389.1.86169 WP_002883389.1.86194 WP_002883389.1.86203 WP_002883389.1.86302 WP_002883389.1.86339 WP_002883389.1.86384 WP_002883389.1.86401 WP_002883389.1.86528 WP_002883389.1.86533 WP_002883389.1.86556 WP_002883389.1.86578 WP_002883389.1.86668 WP_002883389.1.8667 WP_002883389.1.8668 WP_002883389.1.86778 WP_002883389.1.86835 WP_002883389.1.86896 WP_002883389.1.86899 WP_002883389.1.86932 WP_002883389.1.86946 WP_002883389.1.87 WP_002883389.1.87027 WP_002883389.1.87040 WP_002883389.1.87112 WP_002883389.1.87113 WP_002883389.1.87130 WP_002883389.1.87132 WP_002883389.1.87140 WP_002883389.1.87150 WP_002883389.1.87202 WP_002883389.1.87212 WP_002883389.1.87214 WP_002883389.1.87235 WP_002883389.1.87256 WP_002883389.1.87315 WP_002883389.1.87343 WP_002883389.1.87354 WP_002883389.1.87392 WP_002883389.1.87402 WP_002883389.1.87437 WP_002883389.1.87441 WP_002883389.1.8763 WP_002883389.1.87631 WP_002883389.1.87638 WP_002883389.1.87645 WP_002883389.1.87693 WP_002883389.1.87702 WP_002883389.1.8775 WP_002883389.1.87793 WP_002883389.1.87907 WP_002883389.1.87929 WP_002883389.1.87931 WP_002883389.1.87962 WP_002883389.1.88041 WP_002883389.1.88058 WP_002883389.1.88097 WP_002883389.1.88186 WP_002883389.1.88274 WP_002883389.1.88298 WP_002883389.1.8832 WP_002883389.1.88394 WP_002883389.1.88398 WP_002883389.1.88406 WP_002883389.1.88419 WP_002883389.1.88500 WP_002883389.1.8851 WP_002883389.1.88568 WP_002883389.1.88574 WP_002883389.1.88615 WP_002883389.1.88645 WP_002883389.1.88655 WP_002883389.1.88702 WP_002883389.1.88823 WP_002883389.1.88870 WP_002883389.1.88875 WP_002883389.1.88885 WP_002883389.1.8896 WP_002883389.1.8905 WP_002883389.1.89072 WP_002883389.1.89096 WP_002883389.1.89110 WP_002883389.1.89117 WP_002883389.1.89118 WP_002883389.1.89142 WP_002883389.1.89154 WP_002883389.1.892 WP_002883389.1.89226 WP_002883389.1.89259 WP_002883389.1.89300 WP_002883389.1.89315 WP_002883389.1.89318 WP_002883389.1.89326 WP_002883389.1.89327 WP_002883389.1.89340 WP_002883389.1.89342 WP_002883389.1.89401 WP_002883389.1.89467 WP_002883389.1.8952 WP_002883389.1.89524 WP_002883389.1.89526 WP_002883389.1.89558 WP_002883389.1.89602 WP_002883389.1.89618 WP_002883389.1.8966 WP_002883389.1.89688 WP_002883389.1.89692 WP_002883389.1.89722 WP_002883389.1.8983 WP_002883389.1.89958 WP_002883389.1.89961 WP_002883389.1.8999 WP_002883389.1.89991 WP_002883389.1.90020 WP_002883389.1.90051 WP_002883389.1.901 WP_002883389.1.9012 WP_002883389.1.90123 WP_002883389.1.90142 WP_002883389.1.9025 WP_002883389.1.90297 WP_002883389.1.90318 WP_002883389.1.90355 WP_002883389.1.90374 WP_002883389.1.90382 WP_002883389.1.90383 WP_002883389.1.90469 WP_002883389.1.90493 WP_002883389.1.90515 WP_002883389.1.90516 WP_002883389.1.90581 WP_002883389.1.90621 WP_002883389.1.90636 WP_002883389.1.90662 WP_002883389.1.90699 WP_002883389.1.90746 WP_002883389.1.90802 WP_002883389.1.90838 WP_002883389.1.90870 WP_002883389.1.90877 WP_002883389.1.90879 WP_002883389.1.90904 WP_002883389.1.9092 WP_002883389.1.90947 WP_002883389.1.90993 WP_002883389.1.91001 WP_002883389.1.91033 WP_002883389.1.9111 WP_002883389.1.91134 WP_002883389.1.91181 WP_002883389.1.91187 WP_002883389.1.91242 WP_002883389.1.91298 WP_002883389.1.91301 WP_002883389.1.91319 WP_002883389.1.91327 WP_002883389.1.91385 WP_002883389.1.91402 WP_002883389.1.91415 WP_002883389.1.91435 WP_002883389.1.91444 WP_002883389.1.91452 WP_002883389.1.91461 WP_002883389.1.91484 WP_002883389.1.91522 WP_002883389.1.91550 WP_002883389.1.91572 WP_002883389.1.91604 WP_002883389.1.91613 WP_002883389.1.91684 WP_002883389.1.9170 WP_002883389.1.91725 WP_002883389.1.91729 WP_002883389.1.91738 WP_002883389.1.91741 WP_002883389.1.91751 WP_002883389.1.918 WP_002883389.1.91842 WP_002883389.1.91847 WP_002883389.1.91900 WP_002883389.1.91901 WP_002883389.1.91968 WP_002883389.1.91981 WP_002883389.1.92020 WP_002883389.1.92035 WP_002883389.1.92066 WP_002883389.1.92084 WP_002883389.1.92117 WP_002883389.1.9216 WP_002883389.1.92174 WP_002883389.1.92189 WP_002883389.1.92209 WP_002883389.1.92246 WP_002883389.1.92280 WP_002883389.1.92393 WP_002883389.1.92460 WP_002883389.1.925 WP_002883389.1.92569 WP_002883389.1.9258 WP_002883389.1.9259 WP_002883389.1.92601 WP_002883389.1.92608 WP_002883389.1.92704 WP_002883389.1.92746 WP_002883389.1.92771 WP_002883389.1.92782 WP_002883389.1.92788 WP_002883389.1.92873 WP_002883389.1.92901 WP_002883389.1.92984 WP_002883389.1.9300 WP_002883389.1.93004 WP_002883389.1.93031 WP_002883389.1.93058 WP_002883389.1.93070 WP_002883389.1.93081 WP_002883389.1.93131 WP_002883389.1.93132 WP_002883389.1.93161 WP_002883389.1.93246 WP_002883389.1.93256 WP_002883389.1.93278 WP_002883389.1.93308 WP_002883389.1.93369 WP_002883389.1.93445 WP_002883389.1.93494 WP_002883389.1.93502 WP_002883389.1.9353 WP_002883389.1.93685 WP_002883389.1.93757 WP_002883389.1.93764 WP_002883389.1.9383 WP_002883389.1.93879 WP_002883389.1.94021 WP_002883389.1.94033 WP_002883389.1.94163 WP_002883389.1.94200 WP_002883389.1.94290 WP_002883389.1.94493 WP_002883389.1.94518 WP_002883389.1.94599 WP_002883389.1.94605 WP_002883389.1.94608 WP_002883389.1.94642 WP_002883389.1.94696 WP_002883389.1.94701 WP_002883389.1.94777 WP_002883389.1.94837 WP_002883389.1.94860 WP_002883389.1.94894 WP_002883389.1.94909 WP_002883389.1.9492 WP_002883389.1.94956 WP_002883389.1.95021 WP_002883389.1.95030 WP_002883389.1.95122 WP_002883389.1.95238 WP_002883389.1.95299 WP_002883389.1.95405 WP_002883389.1.95408 WP_002883389.1.95429 WP_002883389.1.95486 WP_002883389.1.95524 WP_002883389.1.95527 WP_002883389.1.95562 WP_002883389.1.95593 WP_002883389.1.95645 WP_002883389.1.95697 WP_002883389.1.95710 WP_002883389.1.95723 WP_002883389.1.95742 WP_002883389.1.95743 WP_002883389.1.95754 WP_002883389.1.95775 WP_002883389.1.95843 WP_002883389.1.95889 WP_002883389.1.95898 WP_002883389.1.95927 WP_002883389.1.96010 WP_002883389.1.96131 WP_002883389.1.96202 WP_002883389.1.96225 WP_002883389.1.9626 WP_002883389.1.96300 WP_002883389.1.96374 WP_002883389.1.96375 WP_002883389.1.96383 WP_002883389.1.96405 WP_002883389.1.9651 WP_002883389.1.96549 WP_002883389.1.96645 WP_002883389.1.96684 WP_002883389.1.96737 WP_002883389.1.96793 WP_002883389.1.96802 WP_002883389.1.96842 WP_002883389.1.96881 WP_002883389.1.96915 WP_002883389.1.96979 WP_002883389.1.96991 WP_002883389.1.97025 WP_002883389.1.97037 WP_002883389.1.97092 WP_002883389.1.97114 WP_002883389.1.97186 WP_002883389.1.97197 WP_002883389.1.97236 WP_002883389.1.97263 WP_002883389.1.97273 WP_002883389.1.97294 WP_002883389.1.97333 WP_002883389.1.97353 WP_002883389.1.97416 WP_002883389.1.97419 WP_002883389.1.9745 WP_002883389.1.97475 WP_002883389.1.97567 WP_002883389.1.97636 WP_002883389.1.97680 WP_002883389.1.97697 WP_002883389.1.97728 WP_002883389.1.97734 WP_002883389.1.97747 WP_002883389.1.97759 WP_002883389.1.97794 WP_002883389.1.97833 WP_002883389.1.97855 WP_002883389.1.9800 WP_002883389.1.98016 WP_002883389.1.98024 WP_002883389.1.98125 WP_002883389.1.98184 WP_002883389.1.98278 WP_002883389.1.9831 WP_002883389.1.98311 WP_002883389.1.98320 WP_002883389.1.98336 WP_002883389.1.98408 WP_002883389.1.98420 WP_002883389.1.98450 WP_002883389.1.98499 WP_002883389.1.98553 WP_002883389.1.98631 WP_002883389.1.98728 WP_002883389.1.9875 WP_002883389.1.98774 WP_002883389.1.98816 WP_002883389.1.98871 WP_002883389.1.98932 WP_002883389.1.98973 WP_002883389.1.99007 WP_002883389.1.99013 WP_002883389.1.99016 WP_002883389.1.99166 WP_002883389.1.99245 WP_002883389.1.99248 WP_002883389.1.99264 WP_002883389.1.99279 WP_002883389.1.99305 WP_002883389.1.9934 WP_002883389.1.99439 WP_002883389.1.99691 WP_002883389.1.99706 WP_002883389.1.99778 WP_002883389.1.99794 WP_002883389.1.99873 WP_002883389.1.99885 WP_002883389.1.9996 YP_005224451.1.24690 gi|402783077|ref|YP_006638623.1| gi|550447026|ref|YP_008662830.1| gi|152972795|ref|YP_001337941.1| gi|530632577|ref|YP_008427845.1| gi|238892407|ref|YP_002917141.1| gi|378976310|ref|YP_005224451.1| 272620.KPN_04306 484021.KP1_0166 gi|288937770|ref|YP_003441829.1| gi|386037429|ref|YP_005957342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]