SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238893184|ref|YP_002917918.1| from Klebsiella pneumoniae NTUH-K2044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238893184|ref|YP_002917918.1|
Domain Number 1 Region: 7-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.79e-62
Family PP-loop ATPase 0.0000000519
Further Details:      
 
Domain Number 2 Region: 317-428
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-29
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0000185
Further Details:      
 
Domain Number 3 Region: 227-311
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 4.19e-26
Family MesJ substrate recognition domain-like 0.0000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238893184|ref|YP_002917918.1|
Sequence length 433
Comment tRNA(Ile)-lysidine synthetase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
Sequence
MTADIAHTLHPHRQLLVAFSGGLDSTVLLHQLVLLREQDPSLTLRAVHVHHGLSAHADDW
VAHCRQICQQWQVPLVVHHVTLARGGLGVEAHARAARYQAFQDTLNAGEVLVTAQHQDDQ
CETLLLALKRGSGPTGLSAMAPSSAFAGSRLLRPLLNETRESLRQWALAHQLSWIEDESN
QDDTYDRNFLRLRVIPVLRERWPHFSEAVARSASLCAEQEQLLDEMLAAELASLVAEDGS
LAIAPLASMSPPRRAALLRRWLARQQAPMPAREVPERLWHEVALAREDASPCLRLGEFTV
RRFQQRLYWVKYLPGQTDSVQRWPDWRQPLRLADGLGELTLQPGGRLRPPSADEPVTVRF
RASGHLHIVGRHGGRKLKKLWQELGVAPWRRDTTPLLFYGETPIAAADDLFVTTEGEVKD
GEGVRLMWRKTGD
Download sequence
Identical sequences 484021.KP1_1046 gi|238893184|ref|YP_002917918.1| WP_012737425.1.100635 WP_012737425.1.19533 WP_012737425.1.33806 WP_012737425.1.81744 WP_012737425.1.94608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]