SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238894021|ref|YP_002918755.1| from Klebsiella pneumoniae NTUH-K2044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238894021|ref|YP_002918755.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 4.18e-30
Family YccV-like 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238894021|ref|YP_002918755.1|
Sequence length 105
Comment heat shock protein HspQ [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
Sequence
MIASKFGIGQQVRHTLLGYLGVIVDVDPEYSLAEPEEDEIAANDELRAAPWYHVVMEDDD
GQPIHTYLAEAQLSSETRDEHPEQPSLDELAKTIRQQLQAPRLRN
Download sequence
Identical sequences A0A081M6C2 A0A087FME1 A0A0H3GR50 A0A0J2JJU5 A0A1D3U694 A0A1F2LQ77 A0A1Y0Q297 A0A223UE25 A0A2A5MM22 A0A2G8ASE0 A6T765 B5XY39 C8T886 V0APM9 W1BIS0 W1DW97 W1EAG4 W1EMA6 W1GEF2 W1H8R7 W1HQL8
gi|386034174|ref|YP_005954087.1| 272620.KPN_01000 484021.KP1_1967 507522.KPK_3574 gi|238894021|ref|YP_002918755.1| gi|378978032|ref|YP_005226173.1| gi|288936244|ref|YP_003440303.1| gi|206578872|ref|YP_002239394.1| gi|550444020|ref|YP_008659587.1| WP_002898441.1.100062 WP_002898441.1.100145 WP_002898441.1.100175 WP_002898441.1.100176 WP_002898441.1.100193 WP_002898441.1.100239 WP_002898441.1.100268 WP_002898441.1.100385 WP_002898441.1.100403 WP_002898441.1.100410 WP_002898441.1.100445 WP_002898441.1.100465 WP_002898441.1.100514 WP_002898441.1.100566 WP_002898441.1.100599 WP_002898441.1.10061 WP_002898441.1.100611 WP_002898441.1.100635 WP_002898441.1.100698 WP_002898441.1.100702 WP_002898441.1.100713 WP_002898441.1.100788 WP_002898441.1.100896 WP_002898441.1.10092 WP_002898441.1.100964 WP_002898441.1.100988 WP_002898441.1.10101 WP_002898441.1.10102 WP_002898441.1.101034 WP_002898441.1.101198 WP_002898441.1.101234 WP_002898441.1.101332 WP_002898441.1.10134 WP_002898441.1.101391 WP_002898441.1.101451 WP_002898441.1.101480 WP_002898441.1.101526 WP_002898441.1.101528 WP_002898441.1.101549 WP_002898441.1.101648 WP_002898441.1.101702 WP_002898441.1.101749 WP_002898441.1.101834 WP_002898441.1.101867 WP_002898441.1.101877 WP_002898441.1.101892 WP_002898441.1.10194 WP_002898441.1.101972 WP_002898441.1.10203 WP_002898441.1.102072 WP_002898441.1.102075 WP_002898441.1.102090 WP_002898441.1.10213 WP_002898441.1.102146 WP_002898441.1.10218 WP_002898441.1.10227 WP_002898441.1.10241 WP_002898441.1.10278 WP_002898441.1.10291 WP_002898441.1.10296 WP_002898441.1.10360 WP_002898441.1.10395 WP_002898441.1.10456 WP_002898441.1.10473 WP_002898441.1.10604 WP_002898441.1.1061 WP_002898441.1.10681 WP_002898441.1.10778 WP_002898441.1.10889 WP_002898441.1.10908 WP_002898441.1.11020 WP_002898441.1.11036 WP_002898441.1.11092 WP_002898441.1.11122 WP_002898441.1.11147 WP_002898441.1.11191 WP_002898441.1.11210 WP_002898441.1.11237 WP_002898441.1.11267 WP_002898441.1.11269 WP_002898441.1.11338 WP_002898441.1.11340 WP_002898441.1.11349 WP_002898441.1.11470 WP_002898441.1.11502 WP_002898441.1.11506 WP_002898441.1.11535 WP_002898441.1.11551 WP_002898441.1.11555 WP_002898441.1.11601 WP_002898441.1.11647 WP_002898441.1.11675 WP_002898441.1.11683 WP_002898441.1.11685 WP_002898441.1.11694 WP_002898441.1.11733 WP_002898441.1.11742 WP_002898441.1.11783 WP_002898441.1.11791 WP_002898441.1.11808 WP_002898441.1.11827 WP_002898441.1.11864 WP_002898441.1.11891 WP_002898441.1.1193 WP_002898441.1.11957 WP_002898441.1.11962 WP_002898441.1.11994 WP_002898441.1.12003 WP_002898441.1.12006 WP_002898441.1.12032 WP_002898441.1.12074 WP_002898441.1.12079 WP_002898441.1.12082 WP_002898441.1.12086 WP_002898441.1.12089 WP_002898441.1.12108 WP_002898441.1.12237 WP_002898441.1.12246 WP_002898441.1.1226 WP_002898441.1.12281 WP_002898441.1.12418 WP_002898441.1.12445 WP_002898441.1.1245 WP_002898441.1.12462 WP_002898441.1.12481 WP_002898441.1.12522 WP_002898441.1.12564 WP_002898441.1.12602 WP_002898441.1.12689 WP_002898441.1.12712 WP_002898441.1.12722 WP_002898441.1.12747 WP_002898441.1.12760 WP_002898441.1.12896 WP_002898441.1.12900 WP_002898441.1.1292 WP_002898441.1.12924 WP_002898441.1.12939 WP_002898441.1.1298 WP_002898441.1.12983 WP_002898441.1.13030 WP_002898441.1.13044 WP_002898441.1.13149 WP_002898441.1.13171 WP_002898441.1.13174 WP_002898441.1.13185 WP_002898441.1.13202 WP_002898441.1.1322 WP_002898441.1.13373 WP_002898441.1.13386 WP_002898441.1.13450 WP_002898441.1.13483 WP_002898441.1.13524 WP_002898441.1.13541 WP_002898441.1.13594 WP_002898441.1.13646 WP_002898441.1.13660 WP_002898441.1.13690 WP_002898441.1.13717 WP_002898441.1.13773 WP_002898441.1.13777 WP_002898441.1.13783 WP_002898441.1.13922 WP_002898441.1.14068 WP_002898441.1.14090 WP_002898441.1.14109 WP_002898441.1.14118 WP_002898441.1.14138 WP_002898441.1.14171 WP_002898441.1.14232 WP_002898441.1.14234 WP_002898441.1.14241 WP_002898441.1.14248 WP_002898441.1.14252 WP_002898441.1.14268 WP_002898441.1.14290 WP_002898441.1.14407 WP_002898441.1.1441 WP_002898441.1.14438 WP_002898441.1.14580 WP_002898441.1.14585 WP_002898441.1.14594 WP_002898441.1.14603 WP_002898441.1.1464 WP_002898441.1.14653 WP_002898441.1.14715 WP_002898441.1.14732 WP_002898441.1.14735 WP_002898441.1.1478 WP_002898441.1.14796 WP_002898441.1.14813 WP_002898441.1.14830 WP_002898441.1.14851 WP_002898441.1.14920 WP_002898441.1.14941 WP_002898441.1.14986 WP_002898441.1.14996 WP_002898441.1.1500 WP_002898441.1.15060 WP_002898441.1.15063 WP_002898441.1.15082 WP_002898441.1.1513 WP_002898441.1.15194 WP_002898441.1.15243 WP_002898441.1.15279 WP_002898441.1.15307 WP_002898441.1.1532 WP_002898441.1.15320 WP_002898441.1.15331 WP_002898441.1.15339 WP_002898441.1.15361 WP_002898441.1.15413 WP_002898441.1.15491 WP_002898441.1.15574 WP_002898441.1.15610 WP_002898441.1.15629 WP_002898441.1.15715 WP_002898441.1.1572 WP_002898441.1.15806 WP_002898441.1.15832 WP_002898441.1.15839 WP_002898441.1.15852 WP_002898441.1.15878 WP_002898441.1.15942 WP_002898441.1.1596 WP_002898441.1.15994 WP_002898441.1.160 WP_002898441.1.16054 WP_002898441.1.16128 WP_002898441.1.16196 WP_002898441.1.16289 WP_002898441.1.16299 WP_002898441.1.1631 WP_002898441.1.16314 WP_002898441.1.16326 WP_002898441.1.16348 WP_002898441.1.16380 WP_002898441.1.16505 WP_002898441.1.16515 WP_002898441.1.16536 WP_002898441.1.16542 WP_002898441.1.16559 WP_002898441.1.16659 WP_002898441.1.16738 WP_002898441.1.16758 WP_002898441.1.16830 WP_002898441.1.16877 WP_002898441.1.16917 WP_002898441.1.16928 WP_002898441.1.1702 WP_002898441.1.17053 WP_002898441.1.17211 WP_002898441.1.17236 WP_002898441.1.17326 WP_002898441.1.17342 WP_002898441.1.17508 WP_002898441.1.17556 WP_002898441.1.17587 WP_002898441.1.17661 WP_002898441.1.17736 WP_002898441.1.17761 WP_002898441.1.17768 WP_002898441.1.1782 WP_002898441.1.17846 WP_002898441.1.17921 WP_002898441.1.17926 WP_002898441.1.17930 WP_002898441.1.18096 WP_002898441.1.18148 WP_002898441.1.18150 WP_002898441.1.18171 WP_002898441.1.18176 WP_002898441.1.18217 WP_002898441.1.18227 WP_002898441.1.18241 WP_002898441.1.18284 WP_002898441.1.18296 WP_002898441.1.18351 WP_002898441.1.18378 WP_002898441.1.18409 WP_002898441.1.18431 WP_002898441.1.18434 WP_002898441.1.18443 WP_002898441.1.18515 WP_002898441.1.18552 WP_002898441.1.18599 WP_002898441.1.18664 WP_002898441.1.18682 WP_002898441.1.1869 WP_002898441.1.18695 WP_002898441.1.187 WP_002898441.1.18716 WP_002898441.1.18736 WP_002898441.1.18788 WP_002898441.1.18832 WP_002898441.1.18932 WP_002898441.1.18964 WP_002898441.1.18981 WP_002898441.1.19058 WP_002898441.1.19209 WP_002898441.1.19278 WP_002898441.1.19317 WP_002898441.1.19354 WP_002898441.1.1937 WP_002898441.1.19421 WP_002898441.1.19439 WP_002898441.1.19476 WP_002898441.1.19533 WP_002898441.1.19664 WP_002898441.1.19786 WP_002898441.1.1986 WP_002898441.1.19885 WP_002898441.1.19888 WP_002898441.1.19911 WP_002898441.1.19937 WP_002898441.1.19984 WP_002898441.1.19989 WP_002898441.1.2000 WP_002898441.1.20019 WP_002898441.1.20050 WP_002898441.1.20122 WP_002898441.1.20179 WP_002898441.1.20205 WP_002898441.1.20217 WP_002898441.1.2023 WP_002898441.1.20278 WP_002898441.1.2031 WP_002898441.1.20375 WP_002898441.1.2038 WP_002898441.1.20426 WP_002898441.1.2044 WP_002898441.1.2045 WP_002898441.1.20472 WP_002898441.1.20476 WP_002898441.1.205 WP_002898441.1.20528 WP_002898441.1.2055 WP_002898441.1.20621 WP_002898441.1.20639 WP_002898441.1.20647 WP_002898441.1.2068 WP_002898441.1.20685 WP_002898441.1.20750 WP_002898441.1.20780 WP_002898441.1.20811 WP_002898441.1.20823 WP_002898441.1.20902 WP_002898441.1.20991 WP_002898441.1.21023 WP_002898441.1.21088 WP_002898441.1.21128 WP_002898441.1.21228 WP_002898441.1.21323 WP_002898441.1.2150 WP_002898441.1.21566 WP_002898441.1.21571 WP_002898441.1.21587 WP_002898441.1.21772 WP_002898441.1.21791 WP_002898441.1.21799 WP_002898441.1.21813 WP_002898441.1.21831 WP_002898441.1.21851 WP_002898441.1.21854 WP_002898441.1.21869 WP_002898441.1.21892 WP_002898441.1.21913 WP_002898441.1.2193 WP_002898441.1.21936 WP_002898441.1.21953 WP_002898441.1.21968 WP_002898441.1.22001 WP_002898441.1.22044 WP_002898441.1.22072 WP_002898441.1.22101 WP_002898441.1.22129 WP_002898441.1.22184 WP_002898441.1.22191 WP_002898441.1.22215 WP_002898441.1.22398 WP_002898441.1.22405 WP_002898441.1.2243 WP_002898441.1.22447 WP_002898441.1.22471 WP_002898441.1.2249 WP_002898441.1.2252 WP_002898441.1.22520 WP_002898441.1.22534 WP_002898441.1.22555 WP_002898441.1.2258 WP_002898441.1.22584 WP_002898441.1.22607 WP_002898441.1.22630 WP_002898441.1.22648 WP_002898441.1.2265 WP_002898441.1.22686 WP_002898441.1.22698 WP_002898441.1.22712 WP_002898441.1.2272 WP_002898441.1.22828 WP_002898441.1.22836 WP_002898441.1.22910 WP_002898441.1.22929 WP_002898441.1.22932 WP_002898441.1.22956 WP_002898441.1.23071 WP_002898441.1.23085 WP_002898441.1.23112 WP_002898441.1.23144 WP_002898441.1.23145 WP_002898441.1.23348 WP_002898441.1.23437 WP_002898441.1.23454 WP_002898441.1.2346 WP_002898441.1.2347 WP_002898441.1.23473 WP_002898441.1.2350 WP_002898441.1.23528 WP_002898441.1.23543 WP_002898441.1.23560 WP_002898441.1.23562 WP_002898441.1.23564 WP_002898441.1.23607 WP_002898441.1.23609 WP_002898441.1.23614 WP_002898441.1.23627 WP_002898441.1.2367 WP_002898441.1.23672 WP_002898441.1.23673 WP_002898441.1.23758 WP_002898441.1.23759 WP_002898441.1.23868 WP_002898441.1.23877 WP_002898441.1.23921 WP_002898441.1.23981 WP_002898441.1.23982 WP_002898441.1.24027 WP_002898441.1.24036 WP_002898441.1.24055 WP_002898441.1.24074 WP_002898441.1.24095 WP_002898441.1.24103 WP_002898441.1.2414 WP_002898441.1.24166 WP_002898441.1.24209 WP_002898441.1.24211 WP_002898441.1.24267 WP_002898441.1.2432 WP_002898441.1.24342 WP_002898441.1.24353 WP_002898441.1.244 WP_002898441.1.2447 WP_002898441.1.24566 WP_002898441.1.24587 WP_002898441.1.24590 WP_002898441.1.24635 WP_002898441.1.24707 WP_002898441.1.24801 WP_002898441.1.24816 WP_002898441.1.24822 WP_002898441.1.24887 WP_002898441.1.24890 WP_002898441.1.24911 WP_002898441.1.24919 WP_002898441.1.24951 WP_002898441.1.25122 WP_002898441.1.2513 WP_002898441.1.25163 WP_002898441.1.25169 WP_002898441.1.25198 WP_002898441.1.25239 WP_002898441.1.25254 WP_002898441.1.25275 WP_002898441.1.25306 WP_002898441.1.25318 WP_002898441.1.2536 WP_002898441.1.25379 WP_002898441.1.25391 WP_002898441.1.25407 WP_002898441.1.25429 WP_002898441.1.25492 WP_002898441.1.25559 WP_002898441.1.25563 WP_002898441.1.25575 WP_002898441.1.25582 WP_002898441.1.25904 WP_002898441.1.25918 WP_002898441.1.25920 WP_002898441.1.25933 WP_002898441.1.25938 WP_002898441.1.25942 WP_002898441.1.25969 WP_002898441.1.25987 WP_002898441.1.26045 WP_002898441.1.26067 WP_002898441.1.26200 WP_002898441.1.26219 WP_002898441.1.26285 WP_002898441.1.26299 WP_002898441.1.26308 WP_002898441.1.26336 WP_002898441.1.26342 WP_002898441.1.26396 WP_002898441.1.26427 WP_002898441.1.26448 WP_002898441.1.26449 WP_002898441.1.26475 WP_002898441.1.26515 WP_002898441.1.26522 WP_002898441.1.26545 WP_002898441.1.26639 WP_002898441.1.26675 WP_002898441.1.26727 WP_002898441.1.26762 WP_002898441.1.26824 WP_002898441.1.2683 WP_002898441.1.26830 WP_002898441.1.26843 WP_002898441.1.2686 WP_002898441.1.26890 WP_002898441.1.26974 WP_002898441.1.27037 WP_002898441.1.27054 WP_002898441.1.27121 WP_002898441.1.27144 WP_002898441.1.2716 WP_002898441.1.27224 WP_002898441.1.27264 WP_002898441.1.27268 WP_002898441.1.27319 WP_002898441.1.27356 WP_002898441.1.27443 WP_002898441.1.27477 WP_002898441.1.27488 WP_002898441.1.27543 WP_002898441.1.27550 WP_002898441.1.27703 WP_002898441.1.27722 WP_002898441.1.27766 WP_002898441.1.27809 WP_002898441.1.27828 WP_002898441.1.27925 WP_002898441.1.27952 WP_002898441.1.2796 WP_002898441.1.27991 WP_002898441.1.28049 WP_002898441.1.28083 WP_002898441.1.28086 WP_002898441.1.28112 WP_002898441.1.28115 WP_002898441.1.28135 WP_002898441.1.2814 WP_002898441.1.28152 WP_002898441.1.28196 WP_002898441.1.28203 WP_002898441.1.28291 WP_002898441.1.28375 WP_002898441.1.28435 WP_002898441.1.28446 WP_002898441.1.28463 WP_002898441.1.28640 WP_002898441.1.28660 WP_002898441.1.28688 WP_002898441.1.2870 WP_002898441.1.28717 WP_002898441.1.28752 WP_002898441.1.28764 WP_002898441.1.28857 WP_002898441.1.28910 WP_002898441.1.28927 WP_002898441.1.28928 WP_002898441.1.28972 WP_002898441.1.28974 WP_002898441.1.28992 WP_002898441.1.29021 WP_002898441.1.29072 WP_002898441.1.29120 WP_002898441.1.29152 WP_002898441.1.29240 WP_002898441.1.29305 WP_002898441.1.29333 WP_002898441.1.29334 WP_002898441.1.29346 WP_002898441.1.29392 WP_002898441.1.29424 WP_002898441.1.29448 WP_002898441.1.29466 WP_002898441.1.29506 WP_002898441.1.29529 WP_002898441.1.29583 WP_002898441.1.29636 WP_002898441.1.29726 WP_002898441.1.29748 WP_002898441.1.29772 WP_002898441.1.29816 WP_002898441.1.29829 WP_002898441.1.29858 WP_002898441.1.29871 WP_002898441.1.2990 WP_002898441.1.29915 WP_002898441.1.29974 WP_002898441.1.2999 WP_002898441.1.30010 WP_002898441.1.30072 WP_002898441.1.30078 WP_002898441.1.30132 WP_002898441.1.30184 WP_002898441.1.30207 WP_002898441.1.30218 WP_002898441.1.30264 WP_002898441.1.30296 WP_002898441.1.30300 WP_002898441.1.30339 WP_002898441.1.30390 WP_002898441.1.30416 WP_002898441.1.30426 WP_002898441.1.30455 WP_002898441.1.30471 WP_002898441.1.30478 WP_002898441.1.30539 WP_002898441.1.30576 WP_002898441.1.30634 WP_002898441.1.30638 WP_002898441.1.30704 WP_002898441.1.3081 WP_002898441.1.30897 WP_002898441.1.30929 WP_002898441.1.3099 WP_002898441.1.31061 WP_002898441.1.31064 WP_002898441.1.3111 WP_002898441.1.31257 WP_002898441.1.313 WP_002898441.1.31374 WP_002898441.1.3138 WP_002898441.1.31400 WP_002898441.1.31459 WP_002898441.1.31536 WP_002898441.1.31556 WP_002898441.1.3159 WP_002898441.1.31591 WP_002898441.1.31601 WP_002898441.1.31630 WP_002898441.1.3164 WP_002898441.1.31648 WP_002898441.1.31846 WP_002898441.1.31890 WP_002898441.1.31906 WP_002898441.1.31920 WP_002898441.1.31948 WP_002898441.1.31992 WP_002898441.1.32013 WP_002898441.1.32023 WP_002898441.1.32057 WP_002898441.1.32086 WP_002898441.1.32211 WP_002898441.1.32212 WP_002898441.1.32300 WP_002898441.1.32315 WP_002898441.1.32336 WP_002898441.1.3234 WP_002898441.1.32354 WP_002898441.1.32369 WP_002898441.1.32371 WP_002898441.1.32612 WP_002898441.1.32690 WP_002898441.1.32749 WP_002898441.1.32788 WP_002898441.1.32797 WP_002898441.1.32809 WP_002898441.1.3282 WP_002898441.1.32827 WP_002898441.1.32849 WP_002898441.1.32854 WP_002898441.1.32857 WP_002898441.1.32915 WP_002898441.1.32936 WP_002898441.1.33041 WP_002898441.1.33057 WP_002898441.1.33136 WP_002898441.1.3317 WP_002898441.1.33229 WP_002898441.1.33399 WP_002898441.1.33406 WP_002898441.1.33414 WP_002898441.1.33435 WP_002898441.1.33446 WP_002898441.1.33481 WP_002898441.1.33498 WP_002898441.1.33539 WP_002898441.1.33544 WP_002898441.1.33583 WP_002898441.1.3361 WP_002898441.1.33642 WP_002898441.1.33660 WP_002898441.1.33704 WP_002898441.1.33750 WP_002898441.1.33755 WP_002898441.1.3378 WP_002898441.1.33794 WP_002898441.1.33806 WP_002898441.1.33831 WP_002898441.1.33836 WP_002898441.1.33838 WP_002898441.1.33889 WP_002898441.1.33942 WP_002898441.1.33943 WP_002898441.1.33985 WP_002898441.1.34058 WP_002898441.1.34110 WP_002898441.1.34113 WP_002898441.1.34114 WP_002898441.1.34173 WP_002898441.1.34200 WP_002898441.1.34213 WP_002898441.1.34258 WP_002898441.1.34265 WP_002898441.1.34281 WP_002898441.1.34311 WP_002898441.1.34316 WP_002898441.1.34367 WP_002898441.1.34390 WP_002898441.1.34439 WP_002898441.1.34479 WP_002898441.1.34481 WP_002898441.1.3450 WP_002898441.1.34507 WP_002898441.1.34636 WP_002898441.1.34654 WP_002898441.1.34678 WP_002898441.1.34681 WP_002898441.1.34696 WP_002898441.1.34706 WP_002898441.1.34748 WP_002898441.1.34757 WP_002898441.1.34771 WP_002898441.1.34826 WP_002898441.1.34850 WP_002898441.1.34853 WP_002898441.1.34869 WP_002898441.1.34885 WP_002898441.1.34910 WP_002898441.1.34955 WP_002898441.1.35028 WP_002898441.1.35033 WP_002898441.1.35109 WP_002898441.1.35214 WP_002898441.1.3525 WP_002898441.1.35268 WP_002898441.1.35284 WP_002898441.1.35286 WP_002898441.1.3529 WP_002898441.1.35453 WP_002898441.1.35496 WP_002898441.1.35568 WP_002898441.1.35574 WP_002898441.1.35626 WP_002898441.1.35645 WP_002898441.1.35699 WP_002898441.1.35731 WP_002898441.1.35786 WP_002898441.1.35793 WP_002898441.1.35814 WP_002898441.1.35820 WP_002898441.1.35824 WP_002898441.1.35850 WP_002898441.1.35863 WP_002898441.1.35914 WP_002898441.1.35918 WP_002898441.1.36018 WP_002898441.1.36025 WP_002898441.1.36029 WP_002898441.1.3605 WP_002898441.1.36080 WP_002898441.1.36084 WP_002898441.1.36092 WP_002898441.1.36099 WP_002898441.1.36130 WP_002898441.1.36151 WP_002898441.1.36204 WP_002898441.1.36237 WP_002898441.1.36261 WP_002898441.1.3628 WP_002898441.1.36306 WP_002898441.1.36383 WP_002898441.1.36388 WP_002898441.1.3640 WP_002898441.1.36402 WP_002898441.1.3644 WP_002898441.1.36451 WP_002898441.1.36468 WP_002898441.1.36483 WP_002898441.1.3657 WP_002898441.1.36659 WP_002898441.1.36728 WP_002898441.1.36825 WP_002898441.1.36849 WP_002898441.1.36998 WP_002898441.1.37066 WP_002898441.1.37140 WP_002898441.1.3716 WP_002898441.1.37171 WP_002898441.1.37177 WP_002898441.1.37207 WP_002898441.1.37225 WP_002898441.1.37235 WP_002898441.1.37238 WP_002898441.1.37264 WP_002898441.1.37279 WP_002898441.1.37286 WP_002898441.1.37356 WP_002898441.1.37361 WP_002898441.1.3738 WP_002898441.1.37391 WP_002898441.1.37422 WP_002898441.1.37438 WP_002898441.1.37456 WP_002898441.1.37565 WP_002898441.1.37614 WP_002898441.1.37617 WP_002898441.1.37681 WP_002898441.1.37716 WP_002898441.1.37753 WP_002898441.1.37829 WP_002898441.1.37860 WP_002898441.1.38008 WP_002898441.1.38089 WP_002898441.1.38094 WP_002898441.1.38096 WP_002898441.1.38179 WP_002898441.1.38215 WP_002898441.1.38231 WP_002898441.1.38236 WP_002898441.1.38269 WP_002898441.1.38399 WP_002898441.1.38433 WP_002898441.1.38448 WP_002898441.1.38464 WP_002898441.1.38571 WP_002898441.1.38593 WP_002898441.1.3862 WP_002898441.1.38684 WP_002898441.1.38700 WP_002898441.1.38705 WP_002898441.1.38729 WP_002898441.1.38737 WP_002898441.1.38799 WP_002898441.1.388 WP_002898441.1.38815 WP_002898441.1.38838 WP_002898441.1.38849 WP_002898441.1.3888 WP_002898441.1.38912 WP_002898441.1.38921 WP_002898441.1.38970 WP_002898441.1.39101 WP_002898441.1.39149 WP_002898441.1.39169 WP_002898441.1.39299 WP_002898441.1.39360 WP_002898441.1.39391 WP_002898441.1.39418 WP_002898441.1.39439 WP_002898441.1.39456 WP_002898441.1.39482 WP_002898441.1.39498 WP_002898441.1.39532 WP_002898441.1.39534 WP_002898441.1.39637 WP_002898441.1.39677 WP_002898441.1.39698 WP_002898441.1.39705 WP_002898441.1.39815 WP_002898441.1.3982 WP_002898441.1.39852 WP_002898441.1.39878 WP_002898441.1.3988 WP_002898441.1.3992 WP_002898441.1.4 WP_002898441.1.40042 WP_002898441.1.40054 WP_002898441.1.40078 WP_002898441.1.4009 WP_002898441.1.40145 WP_002898441.1.40185 WP_002898441.1.40201 WP_002898441.1.40295 WP_002898441.1.4032 WP_002898441.1.40394 WP_002898441.1.40396 WP_002898441.1.40527 WP_002898441.1.40551 WP_002898441.1.40561 WP_002898441.1.40587 WP_002898441.1.40597 WP_002898441.1.40604 WP_002898441.1.40614 WP_002898441.1.4064 WP_002898441.1.40675 WP_002898441.1.4069 WP_002898441.1.40798 WP_002898441.1.40817 WP_002898441.1.40825 WP_002898441.1.40866 WP_002898441.1.40878 WP_002898441.1.40913 WP_002898441.1.40967 WP_002898441.1.4098 WP_002898441.1.41003 WP_002898441.1.41049 WP_002898441.1.41073 WP_002898441.1.41095 WP_002898441.1.41096 WP_002898441.1.41159 WP_002898441.1.41182 WP_002898441.1.41221 WP_002898441.1.41282 WP_002898441.1.41283 WP_002898441.1.41303 WP_002898441.1.4131 WP_002898441.1.41336 WP_002898441.1.41352 WP_002898441.1.41358 WP_002898441.1.414 WP_002898441.1.41405 WP_002898441.1.4154 WP_002898441.1.41563 WP_002898441.1.41630 WP_002898441.1.41642 WP_002898441.1.41644 WP_002898441.1.41669 WP_002898441.1.4167 WP_002898441.1.41702 WP_002898441.1.41713 WP_002898441.1.41765 WP_002898441.1.4177 WP_002898441.1.41794 WP_002898441.1.41833 WP_002898441.1.4186 WP_002898441.1.41872 WP_002898441.1.41895 WP_002898441.1.41907 WP_002898441.1.41913 WP_002898441.1.41924 WP_002898441.1.41928 WP_002898441.1.41930 WP_002898441.1.41992 WP_002898441.1.42054 WP_002898441.1.42067 WP_002898441.1.42079 WP_002898441.1.42139 WP_002898441.1.42141 WP_002898441.1.42153 WP_002898441.1.42264 WP_002898441.1.42280 WP_002898441.1.42281 WP_002898441.1.42297 WP_002898441.1.42299 WP_002898441.1.42306 WP_002898441.1.42338 WP_002898441.1.42464 WP_002898441.1.42476 WP_002898441.1.42518 WP_002898441.1.42578 WP_002898441.1.42583 WP_002898441.1.42584 WP_002898441.1.42629 WP_002898441.1.42635 WP_002898441.1.42724 WP_002898441.1.42755 WP_002898441.1.4286 WP_002898441.1.42881 WP_002898441.1.42929 WP_002898441.1.42951 WP_002898441.1.42953 WP_002898441.1.43010 WP_002898441.1.43043 WP_002898441.1.43050 WP_002898441.1.43084 WP_002898441.1.4312 WP_002898441.1.43146 WP_002898441.1.43214 WP_002898441.1.43221 WP_002898441.1.43228 WP_002898441.1.43231 WP_002898441.1.43233 WP_002898441.1.43386 WP_002898441.1.43413 WP_002898441.1.43445 WP_002898441.1.4346 WP_002898441.1.43468 WP_002898441.1.43492 WP_002898441.1.4351 WP_002898441.1.43538 WP_002898441.1.4359 WP_002898441.1.43601 WP_002898441.1.43611 WP_002898441.1.43833 WP_002898441.1.43836 WP_002898441.1.43853 WP_002898441.1.43867 WP_002898441.1.43874 WP_002898441.1.4393 WP_002898441.1.43941 WP_002898441.1.44117 WP_002898441.1.4414 WP_002898441.1.44158 WP_002898441.1.4416 WP_002898441.1.44235 WP_002898441.1.44239 WP_002898441.1.44267 WP_002898441.1.4430 WP_002898441.1.44325 WP_002898441.1.44368 WP_002898441.1.44418 WP_002898441.1.44528 WP_002898441.1.44567 WP_002898441.1.44708 WP_002898441.1.44805 WP_002898441.1.44869 WP_002898441.1.44896 WP_002898441.1.44925 WP_002898441.1.44931 WP_002898441.1.44946 WP_002898441.1.45107 WP_002898441.1.45137 WP_002898441.1.45191 WP_002898441.1.45258 WP_002898441.1.45319 WP_002898441.1.45327 WP_002898441.1.45380 WP_002898441.1.45395 WP_002898441.1.45443 WP_002898441.1.45445 WP_002898441.1.45482 WP_002898441.1.45519 WP_002898441.1.45520 WP_002898441.1.45557 WP_002898441.1.45592 WP_002898441.1.45594 WP_002898441.1.45607 WP_002898441.1.45644 WP_002898441.1.45821 WP_002898441.1.45910 WP_002898441.1.45911 WP_002898441.1.45970 WP_002898441.1.46 WP_002898441.1.46002 WP_002898441.1.46006 WP_002898441.1.46130 WP_002898441.1.46134 WP_002898441.1.46148 WP_002898441.1.46175 WP_002898441.1.46199 WP_002898441.1.46221 WP_002898441.1.46254 WP_002898441.1.46260 WP_002898441.1.46279 WP_002898441.1.46288 WP_002898441.1.46327 WP_002898441.1.46384 WP_002898441.1.46393 WP_002898441.1.46397 WP_002898441.1.4641 WP_002898441.1.46427 WP_002898441.1.46455 WP_002898441.1.4655 WP_002898441.1.46561 WP_002898441.1.46563 WP_002898441.1.4664 WP_002898441.1.46776 WP_002898441.1.46782 WP_002898441.1.46838 WP_002898441.1.46890 WP_002898441.1.4697 WP_002898441.1.46971 WP_002898441.1.46977 WP_002898441.1.46985 WP_002898441.1.47007 WP_002898441.1.47027 WP_002898441.1.47104 WP_002898441.1.47165 WP_002898441.1.47199 WP_002898441.1.472 WP_002898441.1.47252 WP_002898441.1.47264 WP_002898441.1.47302 WP_002898441.1.47354 WP_002898441.1.47371 WP_002898441.1.47376 WP_002898441.1.47378 WP_002898441.1.47379 WP_002898441.1.47413 WP_002898441.1.47419 WP_002898441.1.47461 WP_002898441.1.47521 WP_002898441.1.4760 WP_002898441.1.47623 WP_002898441.1.47641 WP_002898441.1.47661 WP_002898441.1.47716 WP_002898441.1.47760 WP_002898441.1.47777 WP_002898441.1.4779 WP_002898441.1.47815 WP_002898441.1.4787 WP_002898441.1.47871 WP_002898441.1.47885 WP_002898441.1.47887 WP_002898441.1.47919 WP_002898441.1.47922 WP_002898441.1.47982 WP_002898441.1.48022 WP_002898441.1.48110 WP_002898441.1.48138 WP_002898441.1.48228 WP_002898441.1.48237 WP_002898441.1.48255 WP_002898441.1.48274 WP_002898441.1.48362 WP_002898441.1.48402 WP_002898441.1.48442 WP_002898441.1.48496 WP_002898441.1.48514 WP_002898441.1.48539 WP_002898441.1.48587 WP_002898441.1.48606 WP_002898441.1.48609 WP_002898441.1.48673 WP_002898441.1.48686 WP_002898441.1.48793 WP_002898441.1.48850 WP_002898441.1.48859 WP_002898441.1.48871 WP_002898441.1.48887 WP_002898441.1.48893 WP_002898441.1.48900 WP_002898441.1.48904 WP_002898441.1.48972 WP_002898441.1.48975 WP_002898441.1.4900 WP_002898441.1.49006 WP_002898441.1.49035 WP_002898441.1.49052 WP_002898441.1.49069 WP_002898441.1.49133 WP_002898441.1.49151 WP_002898441.1.49157 WP_002898441.1.49194 WP_002898441.1.49209 WP_002898441.1.49267 WP_002898441.1.49307 WP_002898441.1.49333 WP_002898441.1.49353 WP_002898441.1.49394 WP_002898441.1.49424 WP_002898441.1.49438 WP_002898441.1.49480 WP_002898441.1.49568 WP_002898441.1.49579 WP_002898441.1.49589 WP_002898441.1.49613 WP_002898441.1.49695 WP_002898441.1.49721 WP_002898441.1.49762 WP_002898441.1.49809 WP_002898441.1.49817 WP_002898441.1.49829 WP_002898441.1.49834 WP_002898441.1.49877 WP_002898441.1.49887 WP_002898441.1.49897 WP_002898441.1.49933 WP_002898441.1.50018 WP_002898441.1.50022 WP_002898441.1.50029 WP_002898441.1.50049 WP_002898441.1.5011 WP_002898441.1.50133 WP_002898441.1.50165 WP_002898441.1.50193 WP_002898441.1.50195 WP_002898441.1.5023 WP_002898441.1.5026 WP_002898441.1.50283 WP_002898441.1.50321 WP_002898441.1.50335 WP_002898441.1.50342 WP_002898441.1.50364 WP_002898441.1.50429 WP_002898441.1.50434 WP_002898441.1.50465 WP_002898441.1.50493 WP_002898441.1.5054 WP_002898441.1.50541 WP_002898441.1.5057 WP_002898441.1.50619 WP_002898441.1.50672 WP_002898441.1.50693 WP_002898441.1.50730 WP_002898441.1.50823 WP_002898441.1.50831 WP_002898441.1.50866 WP_002898441.1.50910 WP_002898441.1.50927 WP_002898441.1.50992 WP_002898441.1.51016 WP_002898441.1.51090 WP_002898441.1.51105 WP_002898441.1.51132 WP_002898441.1.51135 WP_002898441.1.51176 WP_002898441.1.51181 WP_002898441.1.51311 WP_002898441.1.51312 WP_002898441.1.51347 WP_002898441.1.51372 WP_002898441.1.51390 WP_002898441.1.5140 WP_002898441.1.51400 WP_002898441.1.51401 WP_002898441.1.51413 WP_002898441.1.5143 WP_002898441.1.51438 WP_002898441.1.51448 WP_002898441.1.51479 WP_002898441.1.51560 WP_002898441.1.51561 WP_002898441.1.51563 WP_002898441.1.51599 WP_002898441.1.51614 WP_002898441.1.51670 WP_002898441.1.51688 WP_002898441.1.51698 WP_002898441.1.517 WP_002898441.1.51743 WP_002898441.1.51779 WP_002898441.1.51791 WP_002898441.1.5181 WP_002898441.1.51885 WP_002898441.1.51907 WP_002898441.1.51922 WP_002898441.1.51965 WP_002898441.1.51975 WP_002898441.1.52012 WP_002898441.1.52021 WP_002898441.1.5205 WP_002898441.1.52051 WP_002898441.1.52054 WP_002898441.1.52079 WP_002898441.1.522 WP_002898441.1.52215 WP_002898441.1.52275 WP_002898441.1.52287 WP_002898441.1.52288 WP_002898441.1.52309 WP_002898441.1.52368 WP_002898441.1.52425 WP_002898441.1.52477 WP_002898441.1.52534 WP_002898441.1.5259 WP_002898441.1.52609 WP_002898441.1.52635 WP_002898441.1.52678 WP_002898441.1.52686 WP_002898441.1.52703 WP_002898441.1.52775 WP_002898441.1.52813 WP_002898441.1.52920 WP_002898441.1.52927 WP_002898441.1.52929 WP_002898441.1.52954 WP_002898441.1.53015 WP_002898441.1.53061 WP_002898441.1.53122 WP_002898441.1.53187 WP_002898441.1.53221 WP_002898441.1.53246 WP_002898441.1.53348 WP_002898441.1.53359 WP_002898441.1.53388 WP_002898441.1.53391 WP_002898441.1.53402 WP_002898441.1.53442 WP_002898441.1.53461 WP_002898441.1.53472 WP_002898441.1.53484 WP_002898441.1.53568 WP_002898441.1.53585 WP_002898441.1.53588 WP_002898441.1.53597 WP_002898441.1.53623 WP_002898441.1.53656 WP_002898441.1.53716 WP_002898441.1.53717 WP_002898441.1.53727 WP_002898441.1.53734 WP_002898441.1.53736 WP_002898441.1.53817 WP_002898441.1.53834 WP_002898441.1.53897 WP_002898441.1.53937 WP_002898441.1.53967 WP_002898441.1.53990 WP_002898441.1.53997 WP_002898441.1.540 WP_002898441.1.54011 WP_002898441.1.54045 WP_002898441.1.5406 WP_002898441.1.54129 WP_002898441.1.54212 WP_002898441.1.54353 WP_002898441.1.54380 WP_002898441.1.54448 WP_002898441.1.54556 WP_002898441.1.54676 WP_002898441.1.54739 WP_002898441.1.54786 WP_002898441.1.548 WP_002898441.1.54824 WP_002898441.1.54952 WP_002898441.1.54958 WP_002898441.1.54959 WP_002898441.1.55032 WP_002898441.1.55048 WP_002898441.1.55050 WP_002898441.1.55086 WP_002898441.1.551 WP_002898441.1.55171 WP_002898441.1.55188 WP_002898441.1.55228 WP_002898441.1.55264 WP_002898441.1.55330 WP_002898441.1.5535 WP_002898441.1.55351 WP_002898441.1.55364 WP_002898441.1.55382 WP_002898441.1.55448 WP_002898441.1.55455 WP_002898441.1.55515 WP_002898441.1.55577 WP_002898441.1.55580 WP_002898441.1.55632 WP_002898441.1.55648 WP_002898441.1.55651 WP_002898441.1.55658 WP_002898441.1.55738 WP_002898441.1.55741 WP_002898441.1.5576 WP_002898441.1.55801 WP_002898441.1.5584 WP_002898441.1.55863 WP_002898441.1.55866 WP_002898441.1.55869 WP_002898441.1.55984 WP_002898441.1.56017 WP_002898441.1.56104 WP_002898441.1.56117 WP_002898441.1.56118 WP_002898441.1.56125 WP_002898441.1.56195 WP_002898441.1.5622 WP_002898441.1.56331 WP_002898441.1.5634 WP_002898441.1.56484 WP_002898441.1.56506 WP_002898441.1.56551 WP_002898441.1.56599 WP_002898441.1.56604 WP_002898441.1.56627 WP_002898441.1.56674 WP_002898441.1.56728 WP_002898441.1.56750 WP_002898441.1.568 WP_002898441.1.5682 WP_002898441.1.56847 WP_002898441.1.56897 WP_002898441.1.57112 WP_002898441.1.57139 WP_002898441.1.57200 WP_002898441.1.57239 WP_002898441.1.57310 WP_002898441.1.57325 WP_002898441.1.57365 WP_002898441.1.57398 WP_002898441.1.57421 WP_002898441.1.57435 WP_002898441.1.57455 WP_002898441.1.57475 WP_002898441.1.57497 WP_002898441.1.57501 WP_002898441.1.57618 WP_002898441.1.57624 WP_002898441.1.57630 WP_002898441.1.57643 WP_002898441.1.57648 WP_002898441.1.57662 WP_002898441.1.57702 WP_002898441.1.57704 WP_002898441.1.57716 WP_002898441.1.57747 WP_002898441.1.57877 WP_002898441.1.57886 WP_002898441.1.57914 WP_002898441.1.57940 WP_002898441.1.5797 WP_002898441.1.57993 WP_002898441.1.58028 WP_002898441.1.58091 WP_002898441.1.58099 WP_002898441.1.58118 WP_002898441.1.58134 WP_002898441.1.58176 WP_002898441.1.58224 WP_002898441.1.58230 WP_002898441.1.58280 WP_002898441.1.58300 WP_002898441.1.58307 WP_002898441.1.58399 WP_002898441.1.58426 WP_002898441.1.58466 WP_002898441.1.58479 WP_002898441.1.58533 WP_002898441.1.58579 WP_002898441.1.58594 WP_002898441.1.58631 WP_002898441.1.58685 WP_002898441.1.58720 WP_002898441.1.58739 WP_002898441.1.58752 WP_002898441.1.58771 WP_002898441.1.58865 WP_002898441.1.58873 WP_002898441.1.58890 WP_002898441.1.58914 WP_002898441.1.58945 WP_002898441.1.58967 WP_002898441.1.58980 WP_002898441.1.58985 WP_002898441.1.58994 WP_002898441.1.59015 WP_002898441.1.5903 WP_002898441.1.59031 WP_002898441.1.59042 WP_002898441.1.59069 WP_002898441.1.59074 WP_002898441.1.59115 WP_002898441.1.59172 WP_002898441.1.59222 WP_002898441.1.59279 WP_002898441.1.59485 WP_002898441.1.5951 WP_002898441.1.59518 WP_002898441.1.59557 WP_002898441.1.59559 WP_002898441.1.59600 WP_002898441.1.59616 WP_002898441.1.59620 WP_002898441.1.59661 WP_002898441.1.59705 WP_002898441.1.59708 WP_002898441.1.59729 WP_002898441.1.59743 WP_002898441.1.5975 WP_002898441.1.59796 WP_002898441.1.59840 WP_002898441.1.59865 WP_002898441.1.59873 WP_002898441.1.59924 WP_002898441.1.59936 WP_002898441.1.59972 WP_002898441.1.59993 WP_002898441.1.59996 WP_002898441.1.60020 WP_002898441.1.60038 WP_002898441.1.60060 WP_002898441.1.60074 WP_002898441.1.6018 WP_002898441.1.60266 WP_002898441.1.60276 WP_002898441.1.60283 WP_002898441.1.60336 WP_002898441.1.60372 WP_002898441.1.60416 WP_002898441.1.6042 WP_002898441.1.60483 WP_002898441.1.60511 WP_002898441.1.60534 WP_002898441.1.60564 WP_002898441.1.60587 WP_002898441.1.60611 WP_002898441.1.60627 WP_002898441.1.60681 WP_002898441.1.60745 WP_002898441.1.60774 WP_002898441.1.60830 WP_002898441.1.60843 WP_002898441.1.60861 WP_002898441.1.6089 WP_002898441.1.60905 WP_002898441.1.60922 WP_002898441.1.60964 WP_002898441.1.60972 WP_002898441.1.6099 WP_002898441.1.60995 WP_002898441.1.61061 WP_002898441.1.61079 WP_002898441.1.61178 WP_002898441.1.6122 WP_002898441.1.61272 WP_002898441.1.61416 WP_002898441.1.61488 WP_002898441.1.61556 WP_002898441.1.61572 WP_002898441.1.61618 WP_002898441.1.61640 WP_002898441.1.61672 WP_002898441.1.61740 WP_002898441.1.61775 WP_002898441.1.6180 WP_002898441.1.61812 WP_002898441.1.61898 WP_002898441.1.61940 WP_002898441.1.61973 WP_002898441.1.61994 WP_002898441.1.620 WP_002898441.1.62050 WP_002898441.1.62082 WP_002898441.1.62090 WP_002898441.1.62110 WP_002898441.1.62111 WP_002898441.1.62126 WP_002898441.1.62188 WP_002898441.1.62226 WP_002898441.1.62234 WP_002898441.1.62278 WP_002898441.1.62292 WP_002898441.1.62294 WP_002898441.1.62306 WP_002898441.1.62400 WP_002898441.1.62452 WP_002898441.1.62473 WP_002898441.1.62501 WP_002898441.1.62502 WP_002898441.1.62520 WP_002898441.1.62560 WP_002898441.1.62579 WP_002898441.1.62603 WP_002898441.1.6265 WP_002898441.1.62664 WP_002898441.1.62719 WP_002898441.1.62733 WP_002898441.1.62734 WP_002898441.1.62760 WP_002898441.1.62765 WP_002898441.1.62783 WP_002898441.1.62809 WP_002898441.1.6302 WP_002898441.1.63098 WP_002898441.1.63123 WP_002898441.1.6315 WP_002898441.1.63164 WP_002898441.1.63294 WP_002898441.1.63309 WP_002898441.1.63351 WP_002898441.1.63395 WP_002898441.1.63404 WP_002898441.1.6346 WP_002898441.1.6347 WP_002898441.1.63485 WP_002898441.1.63552 WP_002898441.1.63582 WP_002898441.1.63610 WP_002898441.1.63643 WP_002898441.1.63671 WP_002898441.1.63702 WP_002898441.1.63750 WP_002898441.1.63785 WP_002898441.1.6379 WP_002898441.1.63802 WP_002898441.1.6391 WP_002898441.1.63956 WP_002898441.1.63968 WP_002898441.1.63972 WP_002898441.1.64001 WP_002898441.1.6401 WP_002898441.1.64075 WP_002898441.1.64099 WP_002898441.1.64114 WP_002898441.1.64140 WP_002898441.1.64143 WP_002898441.1.64187 WP_002898441.1.64191 WP_002898441.1.64211 WP_002898441.1.64240 WP_002898441.1.6432 WP_002898441.1.64339 WP_002898441.1.64348 WP_002898441.1.6442 WP_002898441.1.64427 WP_002898441.1.64453 WP_002898441.1.64484 WP_002898441.1.64593 WP_002898441.1.64620 WP_002898441.1.64735 WP_002898441.1.6476 WP_002898441.1.64768 WP_002898441.1.64826 WP_002898441.1.64841 WP_002898441.1.64852 WP_002898441.1.64865 WP_002898441.1.64914 WP_002898441.1.64945 WP_002898441.1.65021 WP_002898441.1.65042 WP_002898441.1.65043 WP_002898441.1.65077 WP_002898441.1.65108 WP_002898441.1.65137 WP_002898441.1.65166 WP_002898441.1.65215 WP_002898441.1.6524 WP_002898441.1.65254 WP_002898441.1.65398 WP_002898441.1.65421 WP_002898441.1.65436 WP_002898441.1.65472 WP_002898441.1.65530 WP_002898441.1.65552 WP_002898441.1.65564 WP_002898441.1.65603 WP_002898441.1.65611 WP_002898441.1.65723 WP_002898441.1.65745 WP_002898441.1.65766 WP_002898441.1.65813 WP_002898441.1.65845 WP_002898441.1.6591 WP_002898441.1.660 WP_002898441.1.66019 WP_002898441.1.66020 WP_002898441.1.66047 WP_002898441.1.66070 WP_002898441.1.66080 WP_002898441.1.6610 WP_002898441.1.66108 WP_002898441.1.66117 WP_002898441.1.66152 WP_002898441.1.66236 WP_002898441.1.66271 WP_002898441.1.66292 WP_002898441.1.66294 WP_002898441.1.66339 WP_002898441.1.66409 WP_002898441.1.66415 WP_002898441.1.66430 WP_002898441.1.66434 WP_002898441.1.6644 WP_002898441.1.66481 WP_002898441.1.66529 WP_002898441.1.66547 WP_002898441.1.66555 WP_002898441.1.66568 WP_002898441.1.66577 WP_002898441.1.66597 WP_002898441.1.66613 WP_002898441.1.66670 WP_002898441.1.6670 WP_002898441.1.66709 WP_002898441.1.66714 WP_002898441.1.66740 WP_002898441.1.66753 WP_002898441.1.6678 WP_002898441.1.66839 WP_002898441.1.66857 WP_002898441.1.66895 WP_002898441.1.66896 WP_002898441.1.66930 WP_002898441.1.66947 WP_002898441.1.66989 WP_002898441.1.6715 WP_002898441.1.67313 WP_002898441.1.6737 WP_002898441.1.67399 WP_002898441.1.67409 WP_002898441.1.6742 WP_002898441.1.67492 WP_002898441.1.67512 WP_002898441.1.6754 WP_002898441.1.67591 WP_002898441.1.67765 WP_002898441.1.67766 WP_002898441.1.6779 WP_002898441.1.67805 WP_002898441.1.67855 WP_002898441.1.67858 WP_002898441.1.67916 WP_002898441.1.67929 WP_002898441.1.67936 WP_002898441.1.67946 WP_002898441.1.68090 WP_002898441.1.68173 WP_002898441.1.68189 WP_002898441.1.6823 WP_002898441.1.68375 WP_002898441.1.68403 WP_002898441.1.68491 WP_002898441.1.68507 WP_002898441.1.68511 WP_002898441.1.68519 WP_002898441.1.68533 WP_002898441.1.68543 WP_002898441.1.68659 WP_002898441.1.6868 WP_002898441.1.68768 WP_002898441.1.68844 WP_002898441.1.68848 WP_002898441.1.6885 WP_002898441.1.68891 WP_002898441.1.68940 WP_002898441.1.68946 WP_002898441.1.68969 WP_002898441.1.68986 WP_002898441.1.69002 WP_002898441.1.69027 WP_002898441.1.69028 WP_002898441.1.69055 WP_002898441.1.69062 WP_002898441.1.6912 WP_002898441.1.69153 WP_002898441.1.69212 WP_002898441.1.69268 WP_002898441.1.69384 WP_002898441.1.69453 WP_002898441.1.69459 WP_002898441.1.69576 WP_002898441.1.69595 WP_002898441.1.69613 WP_002898441.1.69635 WP_002898441.1.69637 WP_002898441.1.69691 WP_002898441.1.69719 WP_002898441.1.69738 WP_002898441.1.69744 WP_002898441.1.69745 WP_002898441.1.69753 WP_002898441.1.69755 WP_002898441.1.69814 WP_002898441.1.69836 WP_002898441.1.69861 WP_002898441.1.69915 WP_002898441.1.69947 WP_002898441.1.6997 WP_002898441.1.7000 WP_002898441.1.70009 WP_002898441.1.70050 WP_002898441.1.70101 WP_002898441.1.70112 WP_002898441.1.70140 WP_002898441.1.702 WP_002898441.1.70499 WP_002898441.1.70519 WP_002898441.1.70543 WP_002898441.1.70550 WP_002898441.1.70666 WP_002898441.1.70681 WP_002898441.1.70718 WP_002898441.1.7072 WP_002898441.1.70765 WP_002898441.1.70847 WP_002898441.1.70859 WP_002898441.1.7087 WP_002898441.1.70870 WP_002898441.1.70873 WP_002898441.1.70966 WP_002898441.1.7103 WP_002898441.1.71035 WP_002898441.1.71056 WP_002898441.1.71092 WP_002898441.1.71100 WP_002898441.1.71212 WP_002898441.1.71241 WP_002898441.1.71286 WP_002898441.1.71291 WP_002898441.1.71296 WP_002898441.1.7136 WP_002898441.1.71387 WP_002898441.1.71393 WP_002898441.1.71504 WP_002898441.1.71611 WP_002898441.1.71625 WP_002898441.1.71634 WP_002898441.1.7168 WP_002898441.1.71704 WP_002898441.1.71720 WP_002898441.1.71751 WP_002898441.1.71804 WP_002898441.1.7181 WP_002898441.1.71838 WP_002898441.1.71913 WP_002898441.1.71990 WP_002898441.1.72139 WP_002898441.1.72154 WP_002898441.1.72201 WP_002898441.1.72214 WP_002898441.1.7223 WP_002898441.1.72274 WP_002898441.1.72341 WP_002898441.1.72406 WP_002898441.1.72482 WP_002898441.1.72575 WP_002898441.1.72597 WP_002898441.1.72609 WP_002898441.1.72632 WP_002898441.1.72673 WP_002898441.1.72688 WP_002898441.1.72713 WP_002898441.1.7273 WP_002898441.1.72735 WP_002898441.1.72746 WP_002898441.1.72763 WP_002898441.1.72765 WP_002898441.1.72899 WP_002898441.1.73009 WP_002898441.1.73038 WP_002898441.1.73170 WP_002898441.1.7320 WP_002898441.1.73208 WP_002898441.1.73236 WP_002898441.1.73301 WP_002898441.1.73316 WP_002898441.1.73319 WP_002898441.1.73332 WP_002898441.1.73472 WP_002898441.1.73510 WP_002898441.1.73558 WP_002898441.1.73562 WP_002898441.1.73589 WP_002898441.1.73635 WP_002898441.1.73689 WP_002898441.1.73691 WP_002898441.1.73732 WP_002898441.1.73742 WP_002898441.1.73770 WP_002898441.1.73780 WP_002898441.1.73887 WP_002898441.1.7390 WP_002898441.1.73904 WP_002898441.1.740 WP_002898441.1.74001 WP_002898441.1.74048 WP_002898441.1.74110 WP_002898441.1.74176 WP_002898441.1.74253 WP_002898441.1.74256 WP_002898441.1.74263 WP_002898441.1.74332 WP_002898441.1.74357 WP_002898441.1.74394 WP_002898441.1.74447 WP_002898441.1.74490 WP_002898441.1.7455 WP_002898441.1.74692 WP_002898441.1.747 WP_002898441.1.74715 WP_002898441.1.74732 WP_002898441.1.74759 WP_002898441.1.74788 WP_002898441.1.74817 WP_002898441.1.74839 WP_002898441.1.7484 WP_002898441.1.74847 WP_002898441.1.74905 WP_002898441.1.74909 WP_002898441.1.74919 WP_002898441.1.7493 WP_002898441.1.74981 WP_002898441.1.750 WP_002898441.1.75005 WP_002898441.1.75007 WP_002898441.1.75013 WP_002898441.1.75014 WP_002898441.1.75035 WP_002898441.1.7510 WP_002898441.1.75115 WP_002898441.1.75152 WP_002898441.1.75283 WP_002898441.1.75307 WP_002898441.1.75366 WP_002898441.1.75396 WP_002898441.1.75398 WP_002898441.1.75418 WP_002898441.1.75439 WP_002898441.1.75457 WP_002898441.1.75501 WP_002898441.1.75561 WP_002898441.1.75572 WP_002898441.1.75592 WP_002898441.1.75608 WP_002898441.1.75625 WP_002898441.1.75637 WP_002898441.1.75719 WP_002898441.1.7574 WP_002898441.1.75748 WP_002898441.1.7578 WP_002898441.1.75784 WP_002898441.1.75829 WP_002898441.1.75832 WP_002898441.1.75888 WP_002898441.1.75909 WP_002898441.1.75961 WP_002898441.1.75962 WP_002898441.1.76001 WP_002898441.1.76090 WP_002898441.1.76107 WP_002898441.1.76199 WP_002898441.1.7623 WP_002898441.1.76245 WP_002898441.1.76292 WP_002898441.1.7631 WP_002898441.1.76316 WP_002898441.1.76370 WP_002898441.1.76412 WP_002898441.1.76416 WP_002898441.1.7649 WP_002898441.1.76496 WP_002898441.1.76512 WP_002898441.1.76537 WP_002898441.1.76539 WP_002898441.1.76561 WP_002898441.1.76607 WP_002898441.1.76626 WP_002898441.1.76657 WP_002898441.1.76819 WP_002898441.1.76832 WP_002898441.1.76889 WP_002898441.1.76912 WP_002898441.1.76935 WP_002898441.1.76943 WP_002898441.1.76991 WP_002898441.1.77034 WP_002898441.1.77077 WP_002898441.1.77085 WP_002898441.1.77105 WP_002898441.1.77211 WP_002898441.1.7730 WP_002898441.1.77304 WP_002898441.1.77307 WP_002898441.1.7733 WP_002898441.1.77340 WP_002898441.1.77367 WP_002898441.1.77467 WP_002898441.1.77516 WP_002898441.1.77519 WP_002898441.1.77545 WP_002898441.1.77547 WP_002898441.1.77586 WP_002898441.1.77645 WP_002898441.1.77655 WP_002898441.1.77696 WP_002898441.1.777 WP_002898441.1.77723 WP_002898441.1.7773 WP_002898441.1.77753 WP_002898441.1.77799 WP_002898441.1.77800 WP_002898441.1.77802 WP_002898441.1.77831 WP_002898441.1.77875 WP_002898441.1.78001 WP_002898441.1.78012 WP_002898441.1.78062 WP_002898441.1.78065 WP_002898441.1.78103 WP_002898441.1.7811 WP_002898441.1.78119 WP_002898441.1.78171 WP_002898441.1.78214 WP_002898441.1.78260 WP_002898441.1.78268 WP_002898441.1.78285 WP_002898441.1.78290 WP_002898441.1.78300 WP_002898441.1.78334 WP_002898441.1.78350 WP_002898441.1.78354 WP_002898441.1.78387 WP_002898441.1.78417 WP_002898441.1.78418 WP_002898441.1.78421 WP_002898441.1.78472 WP_002898441.1.78533 WP_002898441.1.78534 WP_002898441.1.78540 WP_002898441.1.78555 WP_002898441.1.7858 WP_002898441.1.78591 WP_002898441.1.78597 WP_002898441.1.78613 WP_002898441.1.78725 WP_002898441.1.78745 WP_002898441.1.78772 WP_002898441.1.78861 WP_002898441.1.78922 WP_002898441.1.78950 WP_002898441.1.78962 WP_002898441.1.78981 WP_002898441.1.79021 WP_002898441.1.79091 WP_002898441.1.79108 WP_002898441.1.79109 WP_002898441.1.79141 WP_002898441.1.79175 WP_002898441.1.79211 WP_002898441.1.79236 WP_002898441.1.79266 WP_002898441.1.7935 WP_002898441.1.79420 WP_002898441.1.79520 WP_002898441.1.79541 WP_002898441.1.79582 WP_002898441.1.79599 WP_002898441.1.79608 WP_002898441.1.79625 WP_002898441.1.79636 WP_002898441.1.7974 WP_002898441.1.79756 WP_002898441.1.79857 WP_002898441.1.79868 WP_002898441.1.79935 WP_002898441.1.8001 WP_002898441.1.80027 WP_002898441.1.80047 WP_002898441.1.80051 WP_002898441.1.80062 WP_002898441.1.80217 WP_002898441.1.80227 WP_002898441.1.80350 WP_002898441.1.80355 WP_002898441.1.80362 WP_002898441.1.80412 WP_002898441.1.80466 WP_002898441.1.8054 WP_002898441.1.80554 WP_002898441.1.8056 WP_002898441.1.80564 WP_002898441.1.80615 WP_002898441.1.80692 WP_002898441.1.807 WP_002898441.1.80704 WP_002898441.1.80767 WP_002898441.1.80771 WP_002898441.1.80772 WP_002898441.1.80816 WP_002898441.1.80829 WP_002898441.1.81139 WP_002898441.1.81144 WP_002898441.1.81147 WP_002898441.1.81159 WP_002898441.1.81191 WP_002898441.1.81212 WP_002898441.1.81235 WP_002898441.1.81255 WP_002898441.1.81282 WP_002898441.1.81285 WP_002898441.1.81295 WP_002898441.1.81329 WP_002898441.1.81350 WP_002898441.1.81431 WP_002898441.1.81449 WP_002898441.1.81452 WP_002898441.1.81488 WP_002898441.1.81544 WP_002898441.1.81569 WP_002898441.1.81633 WP_002898441.1.81659 WP_002898441.1.81675 WP_002898441.1.81683 WP_002898441.1.81744 WP_002898441.1.81759 WP_002898441.1.81835 WP_002898441.1.81841 WP_002898441.1.81851 WP_002898441.1.81908 WP_002898441.1.82003 WP_002898441.1.82022 WP_002898441.1.82034 WP_002898441.1.82129 WP_002898441.1.82170 WP_002898441.1.82211 WP_002898441.1.82238 WP_002898441.1.82299 WP_002898441.1.82367 WP_002898441.1.82370 WP_002898441.1.82399 WP_002898441.1.82419 WP_002898441.1.82446 WP_002898441.1.82452 WP_002898441.1.8252 WP_002898441.1.82641 WP_002898441.1.82659 WP_002898441.1.82704 WP_002898441.1.82767 WP_002898441.1.82769 WP_002898441.1.82795 WP_002898441.1.82842 WP_002898441.1.82939 WP_002898441.1.8296 WP_002898441.1.82963 WP_002898441.1.83014 WP_002898441.1.83022 WP_002898441.1.83076 WP_002898441.1.83117 WP_002898441.1.8320 WP_002898441.1.83263 WP_002898441.1.83285 WP_002898441.1.83300 WP_002898441.1.83337 WP_002898441.1.83379 WP_002898441.1.83387 WP_002898441.1.83556 WP_002898441.1.8356 WP_002898441.1.83608 WP_002898441.1.83691 WP_002898441.1.83746 WP_002898441.1.83872 WP_002898441.1.83948 WP_002898441.1.84066 WP_002898441.1.84128 WP_002898441.1.84224 WP_002898441.1.84226 WP_002898441.1.84309 WP_002898441.1.84315 WP_002898441.1.84377 WP_002898441.1.84417 WP_002898441.1.8448 WP_002898441.1.84502 WP_002898441.1.84549 WP_002898441.1.84553 WP_002898441.1.84560 WP_002898441.1.84569 WP_002898441.1.84627 WP_002898441.1.8464 WP_002898441.1.84650 WP_002898441.1.84681 WP_002898441.1.84737 WP_002898441.1.84783 WP_002898441.1.84787 WP_002898441.1.84801 WP_002898441.1.84890 WP_002898441.1.84900 WP_002898441.1.85005 WP_002898441.1.85010 WP_002898441.1.85063 WP_002898441.1.85102 WP_002898441.1.85115 WP_002898441.1.85191 WP_002898441.1.85193 WP_002898441.1.85263 WP_002898441.1.85366 WP_002898441.1.85390 WP_002898441.1.85423 WP_002898441.1.85487 WP_002898441.1.8549 WP_002898441.1.85497 WP_002898441.1.85523 WP_002898441.1.85539 WP_002898441.1.85564 WP_002898441.1.85571 WP_002898441.1.85622 WP_002898441.1.85680 WP_002898441.1.85702 WP_002898441.1.85731 WP_002898441.1.85761 WP_002898441.1.85783 WP_002898441.1.85785 WP_002898441.1.858 WP_002898441.1.85805 WP_002898441.1.85812 WP_002898441.1.85877 WP_002898441.1.85954 WP_002898441.1.85957 WP_002898441.1.85960 WP_002898441.1.85965 WP_002898441.1.85970 WP_002898441.1.85985 WP_002898441.1.86031 WP_002898441.1.86039 WP_002898441.1.86074 WP_002898441.1.86169 WP_002898441.1.86194 WP_002898441.1.86203 WP_002898441.1.86302 WP_002898441.1.86339 WP_002898441.1.86401 WP_002898441.1.86528 WP_002898441.1.86533 WP_002898441.1.86556 WP_002898441.1.86578 WP_002898441.1.86668 WP_002898441.1.8667 WP_002898441.1.8668 WP_002898441.1.86737 WP_002898441.1.86778 WP_002898441.1.86835 WP_002898441.1.86896 WP_002898441.1.86899 WP_002898441.1.86932 WP_002898441.1.86946 WP_002898441.1.87 WP_002898441.1.87027 WP_002898441.1.87040 WP_002898441.1.87063 WP_002898441.1.87112 WP_002898441.1.87113 WP_002898441.1.87130 WP_002898441.1.87132 WP_002898441.1.87140 WP_002898441.1.87150 WP_002898441.1.87202 WP_002898441.1.87212 WP_002898441.1.87214 WP_002898441.1.87235 WP_002898441.1.8725 WP_002898441.1.87256 WP_002898441.1.87313 WP_002898441.1.87315 WP_002898441.1.87343 WP_002898441.1.87354 WP_002898441.1.87392 WP_002898441.1.87402 WP_002898441.1.87437 WP_002898441.1.87441 WP_002898441.1.87611 WP_002898441.1.87628 WP_002898441.1.8763 WP_002898441.1.87631 WP_002898441.1.87638 WP_002898441.1.87645 WP_002898441.1.87693 WP_002898441.1.87702 WP_002898441.1.8775 WP_002898441.1.87767 WP_002898441.1.87793 WP_002898441.1.87907 WP_002898441.1.87929 WP_002898441.1.87931 WP_002898441.1.87962 WP_002898441.1.88041 WP_002898441.1.88058 WP_002898441.1.88097 WP_002898441.1.88186 WP_002898441.1.88274 WP_002898441.1.88298 WP_002898441.1.8832 WP_002898441.1.88394 WP_002898441.1.88398 WP_002898441.1.88406 WP_002898441.1.88419 WP_002898441.1.88500 WP_002898441.1.8851 WP_002898441.1.8853 WP_002898441.1.88551 WP_002898441.1.88568 WP_002898441.1.88574 WP_002898441.1.88615 WP_002898441.1.88645 WP_002898441.1.88655 WP_002898441.1.88702 WP_002898441.1.88823 WP_002898441.1.88870 WP_002898441.1.88875 WP_002898441.1.88885 WP_002898441.1.88914 WP_002898441.1.8896 WP_002898441.1.8905 WP_002898441.1.89072 WP_002898441.1.89096 WP_002898441.1.89110 WP_002898441.1.89115 WP_002898441.1.89117 WP_002898441.1.89118 WP_002898441.1.89142 WP_002898441.1.89154 WP_002898441.1.89185 WP_002898441.1.892 WP_002898441.1.89226 WP_002898441.1.89259 WP_002898441.1.89300 WP_002898441.1.89315 WP_002898441.1.89318 WP_002898441.1.89326 WP_002898441.1.89327 WP_002898441.1.89340 WP_002898441.1.89342 WP_002898441.1.89401 WP_002898441.1.89430 WP_002898441.1.89467 WP_002898441.1.8952 WP_002898441.1.89524 WP_002898441.1.89526 WP_002898441.1.89530 WP_002898441.1.89558 WP_002898441.1.89593 WP_002898441.1.89602 WP_002898441.1.89618 WP_002898441.1.8966 WP_002898441.1.89688 WP_002898441.1.89692 WP_002898441.1.89722 WP_002898441.1.8983 WP_002898441.1.89919 WP_002898441.1.89958 WP_002898441.1.89961 WP_002898441.1.8999 WP_002898441.1.89991 WP_002898441.1.90020 WP_002898441.1.90051 WP_002898441.1.901 WP_002898441.1.9012 WP_002898441.1.90123 WP_002898441.1.90142 WP_002898441.1.9025 WP_002898441.1.90297 WP_002898441.1.90318 WP_002898441.1.90355 WP_002898441.1.90374 WP_002898441.1.90382 WP_002898441.1.90383 WP_002898441.1.90424 WP_002898441.1.90446 WP_002898441.1.90469 WP_002898441.1.90493 WP_002898441.1.90515 WP_002898441.1.90516 WP_002898441.1.90581 WP_002898441.1.90621 WP_002898441.1.90636 WP_002898441.1.90662 WP_002898441.1.90699 WP_002898441.1.90746 WP_002898441.1.90802 WP_002898441.1.90838 WP_002898441.1.90870 WP_002898441.1.90877 WP_002898441.1.90879 WP_002898441.1.90904 WP_002898441.1.9092 WP_002898441.1.90947 WP_002898441.1.90993 WP_002898441.1.91001 WP_002898441.1.91033 WP_002898441.1.9111 WP_002898441.1.91134 WP_002898441.1.9117 WP_002898441.1.91181 WP_002898441.1.91187 WP_002898441.1.91242 WP_002898441.1.91298 WP_002898441.1.91301 WP_002898441.1.91319 WP_002898441.1.91327 WP_002898441.1.91385 WP_002898441.1.91402 WP_002898441.1.91415 WP_002898441.1.91435 WP_002898441.1.91444 WP_002898441.1.91452 WP_002898441.1.91461 WP_002898441.1.91484 WP_002898441.1.91522 WP_002898441.1.91534 WP_002898441.1.91544 WP_002898441.1.91550 WP_002898441.1.91572 WP_002898441.1.91604 WP_002898441.1.91613 WP_002898441.1.91676 WP_002898441.1.91678 WP_002898441.1.91684 WP_002898441.1.9170 WP_002898441.1.91725 WP_002898441.1.91729 WP_002898441.1.91738 WP_002898441.1.91741 WP_002898441.1.91751 WP_002898441.1.918 WP_002898441.1.91842 WP_002898441.1.91847 WP_002898441.1.91900 WP_002898441.1.91901 WP_002898441.1.91968 WP_002898441.1.91981 WP_002898441.1.92020 WP_002898441.1.92035 WP_002898441.1.92046 WP_002898441.1.92066 WP_002898441.1.92084 WP_002898441.1.92117 WP_002898441.1.9216 WP_002898441.1.92189 WP_002898441.1.92209 WP_002898441.1.92246 WP_002898441.1.92280 WP_002898441.1.92393 WP_002898441.1.92460 WP_002898441.1.925 WP_002898441.1.92569 WP_002898441.1.9258 WP_002898441.1.9259 WP_002898441.1.92601 WP_002898441.1.92608 WP_002898441.1.92704 WP_002898441.1.92746 WP_002898441.1.92771 WP_002898441.1.92782 WP_002898441.1.92788 WP_002898441.1.92799 WP_002898441.1.92873 WP_002898441.1.92901 WP_002898441.1.92984 WP_002898441.1.9300 WP_002898441.1.93004 WP_002898441.1.93031 WP_002898441.1.93058 WP_002898441.1.93070 WP_002898441.1.93081 WP_002898441.1.93131 WP_002898441.1.93132 WP_002898441.1.93161 WP_002898441.1.93226 WP_002898441.1.93246 WP_002898441.1.93256 WP_002898441.1.93278 WP_002898441.1.93308 WP_002898441.1.93342 WP_002898441.1.93369 WP_002898441.1.93445 WP_002898441.1.93494 WP_002898441.1.93502 WP_002898441.1.9353 WP_002898441.1.93685 WP_002898441.1.93757 WP_002898441.1.93764 WP_002898441.1.9383 WP_002898441.1.93879 WP_002898441.1.94021 WP_002898441.1.94033 WP_002898441.1.94163 WP_002898441.1.94200 WP_002898441.1.94216 WP_002898441.1.94290 WP_002898441.1.94493 WP_002898441.1.94518 WP_002898441.1.94599 WP_002898441.1.94605 WP_002898441.1.94608 WP_002898441.1.94642 WP_002898441.1.94696 WP_002898441.1.94701 WP_002898441.1.94721 WP_002898441.1.94777 WP_002898441.1.94837 WP_002898441.1.94860 WP_002898441.1.94871 WP_002898441.1.94894 WP_002898441.1.94909 WP_002898441.1.9492 WP_002898441.1.94956 WP_002898441.1.95021 WP_002898441.1.95030 WP_002898441.1.95102 WP_002898441.1.9511 WP_002898441.1.95122 WP_002898441.1.95189 WP_002898441.1.9521 WP_002898441.1.95238 WP_002898441.1.95299 WP_002898441.1.95349 WP_002898441.1.95405 WP_002898441.1.95408 WP_002898441.1.95429 WP_002898441.1.95486 WP_002898441.1.95523 WP_002898441.1.95524 WP_002898441.1.95527 WP_002898441.1.95562 WP_002898441.1.95593 WP_002898441.1.95645 WP_002898441.1.95697 WP_002898441.1.95710 WP_002898441.1.95723 WP_002898441.1.95742 WP_002898441.1.95743 WP_002898441.1.95754 WP_002898441.1.95775 WP_002898441.1.95843 WP_002898441.1.95889 WP_002898441.1.95898 WP_002898441.1.95927 WP_002898441.1.96010 WP_002898441.1.96131 WP_002898441.1.96202 WP_002898441.1.96225 WP_002898441.1.9626 WP_002898441.1.96289 WP_002898441.1.96300 WP_002898441.1.96374 WP_002898441.1.96375 WP_002898441.1.96383 WP_002898441.1.96405 WP_002898441.1.9651 WP_002898441.1.96549 WP_002898441.1.96645 WP_002898441.1.96653 WP_002898441.1.96684 WP_002898441.1.96737 WP_002898441.1.96774 WP_002898441.1.96793 WP_002898441.1.96802 WP_002898441.1.96842 WP_002898441.1.96881 WP_002898441.1.96915 WP_002898441.1.96979 WP_002898441.1.96991 WP_002898441.1.97025 WP_002898441.1.97037 WP_002898441.1.97092 WP_002898441.1.97114 WP_002898441.1.97186 WP_002898441.1.97197 WP_002898441.1.97236 WP_002898441.1.97249 WP_002898441.1.97263 WP_002898441.1.97273 WP_002898441.1.97294 WP_002898441.1.97333 WP_002898441.1.97353 WP_002898441.1.97416 WP_002898441.1.97419 WP_002898441.1.9745 WP_002898441.1.97463 WP_002898441.1.97475 WP_002898441.1.97500 WP_002898441.1.97567 WP_002898441.1.97636 WP_002898441.1.97671 WP_002898441.1.97680 WP_002898441.1.97697 WP_002898441.1.97728 WP_002898441.1.97734 WP_002898441.1.97747 WP_002898441.1.97759 WP_002898441.1.97773 WP_002898441.1.97794 WP_002898441.1.97833 WP_002898441.1.97855 WP_002898441.1.9800 WP_002898441.1.98016 WP_002898441.1.98024 WP_002898441.1.98125 WP_002898441.1.98184 WP_002898441.1.98262 WP_002898441.1.98278 WP_002898441.1.9831 WP_002898441.1.98311 WP_002898441.1.98320 WP_002898441.1.98336 WP_002898441.1.98342 WP_002898441.1.98408 WP_002898441.1.98420 WP_002898441.1.98450 WP_002898441.1.98499 WP_002898441.1.98553 WP_002898441.1.98631 WP_002898441.1.98673 WP_002898441.1.98728 WP_002898441.1.9875 WP_002898441.1.98774 WP_002898441.1.98794 WP_002898441.1.98816 WP_002898441.1.98871 WP_002898441.1.98932 WP_002898441.1.98973 WP_002898441.1.99013 WP_002898441.1.99016 WP_002898441.1.99067 WP_002898441.1.99166 WP_002898441.1.99245 WP_002898441.1.99248 WP_002898441.1.99264 WP_002898441.1.99279 WP_002898441.1.99305 WP_002898441.1.9934 WP_002898441.1.99348 WP_002898441.1.99439 WP_002898441.1.99691 WP_002898441.1.99705 WP_002898441.1.99706 WP_002898441.1.99778 WP_002898441.1.99794 WP_002898441.1.99873 WP_002898441.1.99885 WP_002898441.1.99944 WP_002898441.1.9996 YP_005226173.1.24690 gi|402781493|ref|YP_006637039.1| gi|152969557|ref|YP_001334666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]