SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238895230|ref|YP_002919965.1| from Klebsiella pneumoniae NTUH-K2044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238895230|ref|YP_002919965.1|
Domain Number 1 Region: 195-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.57e-78
Family B3/B4 domain of PheRS, PheT 0.00000632
Further Details:      
 
Domain Number 2 Region: 467-690
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.78e-54
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000988
Further Details:      
 
Domain Number 3 Region: 35-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.92e-52
Family Myf domain 0.0025
Further Details:      
 
Domain Number 4 Region: 696-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.32e-30
Family Anticodon-binding domain of PheRS 0.00073
Further Details:      
 
Domain Number 5 Region: 404-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.49e-21
Family Domains B1 and B5 of PheRS-beta, PheT 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238895230|ref|YP_002919965.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
Sequence
MKFSELWLREWVNPAIDSEALSDQITMAGLEVDGVEPVAGSFNGVVVGEVVECGQHPNAD
KLRVTKVNVGGERLLDIVCGAPNCRQGLKVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC
SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA
VLNKAPLNAPEITPVAATIDDVLPIQVDAPQACPRYLGRVVKGINVKAPTPLWMKEKLRR
CGIRSIDAVVDVTNYVLLELGQPMHAFDRDRIEGGIVVRMAKEGETLVLLDGSEAKLDSD
TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY
ERGVDPALQYKALERATRLLIDLCGGEAGPVIDVTSKENLPTRATITLRRSKLDRLIGHH
IADAQVTDILQRLGCEVTVGEGEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPVQ
AGLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQLIHAGEEALILPSPISSE
MSAMRLSLWTGLLGTVVYNQNRQQSRVRIFESGLRFVPDTNAPLGIRQDVMLAGAICGNR
YEEHWTLAKETVDFYDLKGDLEAVLDLTGKLADIEFRAEATTALHPGQSAAIYLKGERIG
FIGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQARDISRFPANRRDIAVLVAENVAA
ADVLAECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATVAR
CVEALKERFQASLRD
Download sequence
Identical sequences A0A0E1CHR5 A0A0H3GUX6 A0A0J2GNB0 A0A0T5IHX3 A0A1Y0PYT7 A0A2G8AR70 J2X7G9 W1BEB5 W1HDA1 W8UTP2
gi|550445108|ref|YP_008660758.1| WP_002909101.1.100062 WP_002909101.1.100176 WP_002909101.1.100193 WP_002909101.1.100385 WP_002909101.1.100410 WP_002909101.1.100445 WP_002909101.1.100514 WP_002909101.1.100566 WP_002909101.1.100599 WP_002909101.1.100611 WP_002909101.1.100635 WP_002909101.1.100698 WP_002909101.1.100702 WP_002909101.1.100713 WP_002909101.1.100896 WP_002909101.1.100988 WP_002909101.1.10101 WP_002909101.1.101198 WP_002909101.1.101332 WP_002909101.1.101391 WP_002909101.1.101451 WP_002909101.1.101480 WP_002909101.1.101528 WP_002909101.1.101549 WP_002909101.1.101648 WP_002909101.1.101749 WP_002909101.1.101834 WP_002909101.1.101867 WP_002909101.1.101877 WP_002909101.1.101892 WP_002909101.1.101972 WP_002909101.1.102072 WP_002909101.1.102075 WP_002909101.1.10213 WP_002909101.1.102146 WP_002909101.1.10218 WP_002909101.1.10227 WP_002909101.1.10278 WP_002909101.1.10291 WP_002909101.1.10360 WP_002909101.1.10456 WP_002909101.1.10473 WP_002909101.1.10604 WP_002909101.1.1061 WP_002909101.1.10889 WP_002909101.1.10908 WP_002909101.1.11092 WP_002909101.1.11191 WP_002909101.1.11210 WP_002909101.1.11237 WP_002909101.1.11269 WP_002909101.1.11338 WP_002909101.1.11340 WP_002909101.1.11349 WP_002909101.1.11502 WP_002909101.1.11506 WP_002909101.1.11551 WP_002909101.1.11555 WP_002909101.1.11601 WP_002909101.1.11647 WP_002909101.1.11694 WP_002909101.1.11791 WP_002909101.1.11827 WP_002909101.1.1193 WP_002909101.1.11962 WP_002909101.1.11994 WP_002909101.1.12003 WP_002909101.1.12006 WP_002909101.1.12032 WP_002909101.1.12074 WP_002909101.1.12082 WP_002909101.1.12089 WP_002909101.1.12108 WP_002909101.1.12237 WP_002909101.1.1226 WP_002909101.1.12281 WP_002909101.1.12418 WP_002909101.1.12445 WP_002909101.1.1245 WP_002909101.1.12564 WP_002909101.1.12602 WP_002909101.1.12689 WP_002909101.1.12712 WP_002909101.1.12896 WP_002909101.1.12900 WP_002909101.1.12939 WP_002909101.1.1298 WP_002909101.1.13030 WP_002909101.1.13044 WP_002909101.1.13149 WP_002909101.1.13171 WP_002909101.1.13202 WP_002909101.1.13373 WP_002909101.1.13450 WP_002909101.1.13483 WP_002909101.1.13524 WP_002909101.1.13541 WP_002909101.1.13594 WP_002909101.1.13646 WP_002909101.1.13660 WP_002909101.1.13690 WP_002909101.1.13717 WP_002909101.1.13783 WP_002909101.1.13922 WP_002909101.1.14068 WP_002909101.1.14090 WP_002909101.1.14118 WP_002909101.1.14138 WP_002909101.1.14232 WP_002909101.1.14234 WP_002909101.1.14241 WP_002909101.1.14252 WP_002909101.1.14268 WP_002909101.1.14290 WP_002909101.1.14407 WP_002909101.1.1441 WP_002909101.1.14438 WP_002909101.1.14580 WP_002909101.1.14603 WP_002909101.1.1464 WP_002909101.1.14796 WP_002909101.1.14813 WP_002909101.1.14830 WP_002909101.1.14851 WP_002909101.1.14920 WP_002909101.1.14941 WP_002909101.1.14986 WP_002909101.1.14996 WP_002909101.1.1500 WP_002909101.1.15063 WP_002909101.1.15082 WP_002909101.1.1513 WP_002909101.1.15194 WP_002909101.1.15279 WP_002909101.1.15320 WP_002909101.1.15339 WP_002909101.1.15361 WP_002909101.1.15491 WP_002909101.1.15610 WP_002909101.1.15629 WP_002909101.1.15715 WP_002909101.1.1572 WP_002909101.1.15806 WP_002909101.1.15839 WP_002909101.1.15942 WP_002909101.1.1596 WP_002909101.1.15994 WP_002909101.1.16054 WP_002909101.1.16196 WP_002909101.1.1631 WP_002909101.1.16314 WP_002909101.1.16348 WP_002909101.1.16505 WP_002909101.1.16515 WP_002909101.1.16536 WP_002909101.1.16559 WP_002909101.1.16659 WP_002909101.1.16758 WP_002909101.1.16830 WP_002909101.1.16877 WP_002909101.1.16928 WP_002909101.1.17053 WP_002909101.1.17211 WP_002909101.1.17236 WP_002909101.1.17342 WP_002909101.1.17556 WP_002909101.1.17587 WP_002909101.1.17661 WP_002909101.1.17736 WP_002909101.1.17768 WP_002909101.1.1782 WP_002909101.1.17846 WP_002909101.1.17921 WP_002909101.1.17926 WP_002909101.1.17930 WP_002909101.1.18096 WP_002909101.1.18148 WP_002909101.1.18217 WP_002909101.1.18227 WP_002909101.1.18241 WP_002909101.1.18284 WP_002909101.1.18351 WP_002909101.1.18431 WP_002909101.1.18434 WP_002909101.1.18443 WP_002909101.1.18515 WP_002909101.1.18552 WP_002909101.1.18599 WP_002909101.1.18664 WP_002909101.1.18695 WP_002909101.1.187 WP_002909101.1.18788 WP_002909101.1.18932 WP_002909101.1.18964 WP_002909101.1.18981 WP_002909101.1.19058 WP_002909101.1.19209 WP_002909101.1.19278 WP_002909101.1.19317 WP_002909101.1.19354 WP_002909101.1.19421 WP_002909101.1.19476 WP_002909101.1.19533 WP_002909101.1.19664 WP_002909101.1.19786 WP_002909101.1.19885 WP_002909101.1.19911 WP_002909101.1.19937 WP_002909101.1.19989 WP_002909101.1.2000 WP_002909101.1.20019 WP_002909101.1.20217 WP_002909101.1.2031 WP_002909101.1.20375 WP_002909101.1.2038 WP_002909101.1.20426 WP_002909101.1.2044 WP_002909101.1.2045 WP_002909101.1.20472 WP_002909101.1.205 WP_002909101.1.20528 WP_002909101.1.20621 WP_002909101.1.20639 WP_002909101.1.20647 WP_002909101.1.2068 WP_002909101.1.20811 WP_002909101.1.20823 WP_002909101.1.20902 WP_002909101.1.20991 WP_002909101.1.21023 WP_002909101.1.21323 WP_002909101.1.2150 WP_002909101.1.21566 WP_002909101.1.21587 WP_002909101.1.21772 WP_002909101.1.21791 WP_002909101.1.21799 WP_002909101.1.21831 WP_002909101.1.21851 WP_002909101.1.21854 WP_002909101.1.21869 WP_002909101.1.21892 WP_002909101.1.21913 WP_002909101.1.21936 WP_002909101.1.21968 WP_002909101.1.22001 WP_002909101.1.22072 WP_002909101.1.22101 WP_002909101.1.22129 WP_002909101.1.22184 WP_002909101.1.22191 WP_002909101.1.22398 WP_002909101.1.22405 WP_002909101.1.2243 WP_002909101.1.22447 WP_002909101.1.22471 WP_002909101.1.2249 WP_002909101.1.2252 WP_002909101.1.22520 WP_002909101.1.22534 WP_002909101.1.22555 WP_002909101.1.22584 WP_002909101.1.22607 WP_002909101.1.22686 WP_002909101.1.22698 WP_002909101.1.2272 WP_002909101.1.22828 WP_002909101.1.22910 WP_002909101.1.22932 WP_002909101.1.23071 WP_002909101.1.23085 WP_002909101.1.23112 WP_002909101.1.23144 WP_002909101.1.23348 WP_002909101.1.23437 WP_002909101.1.23454 WP_002909101.1.2350 WP_002909101.1.23543 WP_002909101.1.23560 WP_002909101.1.23564 WP_002909101.1.23607 WP_002909101.1.23609 WP_002909101.1.23614 WP_002909101.1.23673 WP_002909101.1.23868 WP_002909101.1.23877 WP_002909101.1.23921 WP_002909101.1.23981 WP_002909101.1.24027 WP_002909101.1.24036 WP_002909101.1.24074 WP_002909101.1.24095 WP_002909101.1.2414 WP_002909101.1.24166 WP_002909101.1.24211 WP_002909101.1.24267 WP_002909101.1.24353 WP_002909101.1.244 WP_002909101.1.2447 WP_002909101.1.24566 WP_002909101.1.24635 WP_002909101.1.24707 WP_002909101.1.24801 WP_002909101.1.24890 WP_002909101.1.24911 WP_002909101.1.24919 WP_002909101.1.24951 WP_002909101.1.25122 WP_002909101.1.2513 WP_002909101.1.25198 WP_002909101.1.25254 WP_002909101.1.25275 WP_002909101.1.25306 WP_002909101.1.25379 WP_002909101.1.25391 WP_002909101.1.25429 WP_002909101.1.25933 WP_002909101.1.25938 WP_002909101.1.25969 WP_002909101.1.25987 WP_002909101.1.26045 WP_002909101.1.26067 WP_002909101.1.26200 WP_002909101.1.26219 WP_002909101.1.26342 WP_002909101.1.26396 WP_002909101.1.26448 WP_002909101.1.26475 WP_002909101.1.26515 WP_002909101.1.26639 WP_002909101.1.2683 WP_002909101.1.26830 WP_002909101.1.27054 WP_002909101.1.27121 WP_002909101.1.27224 WP_002909101.1.27264 WP_002909101.1.27356 WP_002909101.1.27477 WP_002909101.1.27550 WP_002909101.1.27703 WP_002909101.1.27766 WP_002909101.1.27809 WP_002909101.1.27952 WP_002909101.1.2796 WP_002909101.1.28083 WP_002909101.1.28086 WP_002909101.1.28112 WP_002909101.1.28135 WP_002909101.1.28152 WP_002909101.1.28291 WP_002909101.1.28375 WP_002909101.1.28446 WP_002909101.1.28640 WP_002909101.1.28660 WP_002909101.1.2870 WP_002909101.1.28717 WP_002909101.1.28752 WP_002909101.1.28910 WP_002909101.1.28927 WP_002909101.1.28972 WP_002909101.1.28974 WP_002909101.1.29021 WP_002909101.1.29072 WP_002909101.1.29346 WP_002909101.1.29424 WP_002909101.1.29448 WP_002909101.1.29529 WP_002909101.1.29636 WP_002909101.1.29748 WP_002909101.1.29772 WP_002909101.1.29816 WP_002909101.1.29871 WP_002909101.1.29915 WP_002909101.1.30010 WP_002909101.1.30078 WP_002909101.1.30132 WP_002909101.1.30218 WP_002909101.1.30264 WP_002909101.1.30296 WP_002909101.1.30300 WP_002909101.1.30426 WP_002909101.1.30455 WP_002909101.1.30471 WP_002909101.1.30576 WP_002909101.1.30634 WP_002909101.1.30638 WP_002909101.1.30704 WP_002909101.1.3081 WP_002909101.1.30897 WP_002909101.1.30929 WP_002909101.1.3099 WP_002909101.1.31061 WP_002909101.1.31257 WP_002909101.1.313 WP_002909101.1.31374 WP_002909101.1.3138 WP_002909101.1.31400 WP_002909101.1.31459 WP_002909101.1.31536 WP_002909101.1.3159 WP_002909101.1.31591 WP_002909101.1.31601 WP_002909101.1.3164 WP_002909101.1.31648 WP_002909101.1.31846 WP_002909101.1.31890 WP_002909101.1.31938 WP_002909101.1.31948 WP_002909101.1.31992 WP_002909101.1.32013 WP_002909101.1.32023 WP_002909101.1.32057 WP_002909101.1.32086 WP_002909101.1.32211 WP_002909101.1.32212 WP_002909101.1.32315 WP_002909101.1.32336 WP_002909101.1.3234 WP_002909101.1.32354 WP_002909101.1.32369 WP_002909101.1.32371 WP_002909101.1.32612 WP_002909101.1.32690 WP_002909101.1.32788 WP_002909101.1.32809 WP_002909101.1.32827 WP_002909101.1.32849 WP_002909101.1.32857 WP_002909101.1.32915 WP_002909101.1.33041 WP_002909101.1.33057 WP_002909101.1.33136 WP_002909101.1.3317 WP_002909101.1.33229 WP_002909101.1.33406 WP_002909101.1.33414 WP_002909101.1.33435 WP_002909101.1.33446 WP_002909101.1.33481 WP_002909101.1.33539 WP_002909101.1.3361 WP_002909101.1.33660 WP_002909101.1.33704 WP_002909101.1.33750 WP_002909101.1.3378 WP_002909101.1.33794 WP_002909101.1.33806 WP_002909101.1.33831 WP_002909101.1.33889 WP_002909101.1.33942 WP_002909101.1.33943 WP_002909101.1.33985 WP_002909101.1.34110 WP_002909101.1.34113 WP_002909101.1.34173 WP_002909101.1.34200 WP_002909101.1.34265 WP_002909101.1.34281 WP_002909101.1.34311 WP_002909101.1.34316 WP_002909101.1.34390 WP_002909101.1.34439 WP_002909101.1.34481 WP_002909101.1.34636 WP_002909101.1.34654 WP_002909101.1.34678 WP_002909101.1.34681 WP_002909101.1.34696 WP_002909101.1.34706 WP_002909101.1.34748 WP_002909101.1.34757 WP_002909101.1.34826 WP_002909101.1.34850 WP_002909101.1.34869 WP_002909101.1.34885 WP_002909101.1.35033 WP_002909101.1.35109 WP_002909101.1.35214 WP_002909101.1.3525 WP_002909101.1.35496 WP_002909101.1.35568 WP_002909101.1.35626 WP_002909101.1.35645 WP_002909101.1.35699 WP_002909101.1.35731 WP_002909101.1.35786 WP_002909101.1.35793 WP_002909101.1.35814 WP_002909101.1.35850 WP_002909101.1.35863 WP_002909101.1.35918 WP_002909101.1.36018 WP_002909101.1.3605 WP_002909101.1.36092 WP_002909101.1.36099 WP_002909101.1.36130 WP_002909101.1.36204 WP_002909101.1.36261 WP_002909101.1.3628 WP_002909101.1.36306 WP_002909101.1.36383 WP_002909101.1.3640 WP_002909101.1.36402 WP_002909101.1.3644 WP_002909101.1.36451 WP_002909101.1.36483 WP_002909101.1.36728 WP_002909101.1.36825 WP_002909101.1.36849 WP_002909101.1.37066 WP_002909101.1.37140 WP_002909101.1.3716 WP_002909101.1.37171 WP_002909101.1.37177 WP_002909101.1.37235 WP_002909101.1.37238 WP_002909101.1.37264 WP_002909101.1.37279 WP_002909101.1.37286 WP_002909101.1.37356 WP_002909101.1.37361 WP_002909101.1.37391 WP_002909101.1.37422 WP_002909101.1.37438 WP_002909101.1.37614 WP_002909101.1.37716 WP_002909101.1.37829 WP_002909101.1.38089 WP_002909101.1.38094 WP_002909101.1.38096 WP_002909101.1.38179 WP_002909101.1.38231 WP_002909101.1.38236 WP_002909101.1.38269 WP_002909101.1.38433 WP_002909101.1.3862 WP_002909101.1.38684 WP_002909101.1.38700 WP_002909101.1.38705 WP_002909101.1.38729 WP_002909101.1.38737 WP_002909101.1.388 WP_002909101.1.38815 WP_002909101.1.3888 WP_002909101.1.38912 WP_002909101.1.38921 WP_002909101.1.38970 WP_002909101.1.39101 WP_002909101.1.39169 WP_002909101.1.39299 WP_002909101.1.39360 WP_002909101.1.39391 WP_002909101.1.39418 WP_002909101.1.39439 WP_002909101.1.39498 WP_002909101.1.39534 WP_002909101.1.39677 WP_002909101.1.39698 WP_002909101.1.39705 WP_002909101.1.39815 WP_002909101.1.3982 WP_002909101.1.39852 WP_002909101.1.39878 WP_002909101.1.3992 WP_002909101.1.4 WP_002909101.1.40054 WP_002909101.1.40145 WP_002909101.1.40185 WP_002909101.1.40201 WP_002909101.1.40527 WP_002909101.1.40561 WP_002909101.1.40587 WP_002909101.1.40604 WP_002909101.1.40675 WP_002909101.1.4069 WP_002909101.1.4072 WP_002909101.1.40967 WP_002909101.1.4098 WP_002909101.1.41003 WP_002909101.1.41049 WP_002909101.1.41073 WP_002909101.1.41095 WP_002909101.1.41182 WP_002909101.1.41221 WP_002909101.1.41282 WP_002909101.1.41303 WP_002909101.1.4131 WP_002909101.1.41336 WP_002909101.1.41405 WP_002909101.1.4154 WP_002909101.1.41563 WP_002909101.1.41630 WP_002909101.1.41669 WP_002909101.1.4167 WP_002909101.1.41702 WP_002909101.1.41713 WP_002909101.1.41765 WP_002909101.1.4177 WP_002909101.1.41833 WP_002909101.1.41872 WP_002909101.1.41907 WP_002909101.1.41924 WP_002909101.1.41928 WP_002909101.1.41930 WP_002909101.1.42079 WP_002909101.1.42139 WP_002909101.1.42153 WP_002909101.1.42280 WP_002909101.1.42297 WP_002909101.1.42299 WP_002909101.1.42306 WP_002909101.1.42338 WP_002909101.1.42476 WP_002909101.1.42578 WP_002909101.1.42583 WP_002909101.1.42629 WP_002909101.1.42635 WP_002909101.1.42755 WP_002909101.1.42929 WP_002909101.1.42951 WP_002909101.1.42953 WP_002909101.1.43010 WP_002909101.1.4312 WP_002909101.1.43214 WP_002909101.1.43228 WP_002909101.1.43231 WP_002909101.1.43233 WP_002909101.1.43386 WP_002909101.1.43413 WP_002909101.1.43445 WP_002909101.1.4346 WP_002909101.1.43468 WP_002909101.1.43492 WP_002909101.1.4351 WP_002909101.1.43538 WP_002909101.1.4359 WP_002909101.1.43611 WP_002909101.1.43836 WP_002909101.1.43853 WP_002909101.1.43867 WP_002909101.1.43874 WP_002909101.1.4393 WP_002909101.1.4416 WP_002909101.1.44267 WP_002909101.1.4430 WP_002909101.1.44325 WP_002909101.1.44368 WP_002909101.1.44418 WP_002909101.1.44528 WP_002909101.1.44567 WP_002909101.1.44896 WP_002909101.1.44931 WP_002909101.1.44946 WP_002909101.1.45107 WP_002909101.1.45191 WP_002909101.1.45258 WP_002909101.1.45319 WP_002909101.1.45327 WP_002909101.1.45380 WP_002909101.1.45395 WP_002909101.1.45443 WP_002909101.1.45519 WP_002909101.1.45520 WP_002909101.1.45557 WP_002909101.1.45592 WP_002909101.1.45594 WP_002909101.1.45607 WP_002909101.1.45644 WP_002909101.1.45910 WP_002909101.1.45970 WP_002909101.1.46 WP_002909101.1.46002 WP_002909101.1.46130 WP_002909101.1.46175 WP_002909101.1.46199 WP_002909101.1.46221 WP_002909101.1.46260 WP_002909101.1.46279 WP_002909101.1.46288 WP_002909101.1.46327 WP_002909101.1.46393 WP_002909101.1.46397 WP_002909101.1.4641 WP_002909101.1.46427 WP_002909101.1.46455 WP_002909101.1.4655 WP_002909101.1.46561 WP_002909101.1.46563 WP_002909101.1.46782 WP_002909101.1.46890 WP_002909101.1.47007 WP_002909101.1.47027 WP_002909101.1.47165 WP_002909101.1.47252 WP_002909101.1.47302 WP_002909101.1.47354 WP_002909101.1.47371 WP_002909101.1.47376 WP_002909101.1.47378 WP_002909101.1.47379 WP_002909101.1.47413 WP_002909101.1.47419 WP_002909101.1.47461 WP_002909101.1.47521 WP_002909101.1.4760 WP_002909101.1.47623 WP_002909101.1.47641 WP_002909101.1.47661 WP_002909101.1.47716 WP_002909101.1.47760 WP_002909101.1.47777 WP_002909101.1.4779 WP_002909101.1.47885 WP_002909101.1.47887 WP_002909101.1.47919 WP_002909101.1.47922 WP_002909101.1.47982 WP_002909101.1.48022 WP_002909101.1.48138 WP_002909101.1.48228 WP_002909101.1.48237 WP_002909101.1.48255 WP_002909101.1.48362 WP_002909101.1.48402 WP_002909101.1.48442 WP_002909101.1.48496 WP_002909101.1.48539 WP_002909101.1.48587 WP_002909101.1.48606 WP_002909101.1.48609 WP_002909101.1.48673 WP_002909101.1.48686 WP_002909101.1.48850 WP_002909101.1.48859 WP_002909101.1.48887 WP_002909101.1.48900 WP_002909101.1.48972 WP_002909101.1.48975 WP_002909101.1.4900 WP_002909101.1.49006 WP_002909101.1.49035 WP_002909101.1.49069 WP_002909101.1.49133 WP_002909101.1.49151 WP_002909101.1.49157 WP_002909101.1.49194 WP_002909101.1.49333 WP_002909101.1.49353 WP_002909101.1.49394 WP_002909101.1.49613 WP_002909101.1.49721 WP_002909101.1.49762 WP_002909101.1.49817 WP_002909101.1.49829 WP_002909101.1.49834 WP_002909101.1.49897 WP_002909101.1.49933 WP_002909101.1.50022 WP_002909101.1.50049 WP_002909101.1.5011 WP_002909101.1.50133 WP_002909101.1.50165 WP_002909101.1.50193 WP_002909101.1.5023 WP_002909101.1.5026 WP_002909101.1.50283 WP_002909101.1.50321 WP_002909101.1.50335 WP_002909101.1.50342 WP_002909101.1.50364 WP_002909101.1.50429 WP_002909101.1.50465 WP_002909101.1.50493 WP_002909101.1.5054 WP_002909101.1.5057 WP_002909101.1.50619 WP_002909101.1.50672 WP_002909101.1.50693 WP_002909101.1.50823 WP_002909101.1.50866 WP_002909101.1.50910 WP_002909101.1.50927 WP_002909101.1.51016 WP_002909101.1.51090 WP_002909101.1.51105 WP_002909101.1.51132 WP_002909101.1.51135 WP_002909101.1.51176 WP_002909101.1.51181 WP_002909101.1.51311 WP_002909101.1.51312 WP_002909101.1.51372 WP_002909101.1.51390 WP_002909101.1.5140 WP_002909101.1.51401 WP_002909101.1.51479 WP_002909101.1.51560 WP_002909101.1.51599 WP_002909101.1.51670 WP_002909101.1.51688 WP_002909101.1.51743 WP_002909101.1.51779 WP_002909101.1.5181 WP_002909101.1.51885 WP_002909101.1.51907 WP_002909101.1.51922 WP_002909101.1.51965 WP_002909101.1.51975 WP_002909101.1.52012 WP_002909101.1.52051 WP_002909101.1.52079 WP_002909101.1.522 WP_002909101.1.52215 WP_002909101.1.52275 WP_002909101.1.52288 WP_002909101.1.52309 WP_002909101.1.52368 WP_002909101.1.52477 WP_002909101.1.52534 WP_002909101.1.52609 WP_002909101.1.52635 WP_002909101.1.52686 WP_002909101.1.52703 WP_002909101.1.52775 WP_002909101.1.52920 WP_002909101.1.52927 WP_002909101.1.52929 WP_002909101.1.53015 WP_002909101.1.53061 WP_002909101.1.53122 WP_002909101.1.53187 WP_002909101.1.53246 WP_002909101.1.53348 WP_002909101.1.53359 WP_002909101.1.53388 WP_002909101.1.53402 WP_002909101.1.53442 WP_002909101.1.53484 WP_002909101.1.53568 WP_002909101.1.53585 WP_002909101.1.53588 WP_002909101.1.53597 WP_002909101.1.53623 WP_002909101.1.53656 WP_002909101.1.53716 WP_002909101.1.53817 WP_002909101.1.53834 WP_002909101.1.53897 WP_002909101.1.53990 WP_002909101.1.54011 WP_002909101.1.54045 WP_002909101.1.5406 WP_002909101.1.54129 WP_002909101.1.54212 WP_002909101.1.54353 WP_002909101.1.54380 WP_002909101.1.54448 WP_002909101.1.54676 WP_002909101.1.54739 WP_002909101.1.548 WP_002909101.1.54824 WP_002909101.1.54952 WP_002909101.1.54958 WP_002909101.1.54959 WP_002909101.1.55032 WP_002909101.1.55050 WP_002909101.1.551 WP_002909101.1.55171 WP_002909101.1.55188 WP_002909101.1.55228 WP_002909101.1.55264 WP_002909101.1.55351 WP_002909101.1.55364 WP_002909101.1.55382 WP_002909101.1.55455 WP_002909101.1.55577 WP_002909101.1.55580 WP_002909101.1.55648 WP_002909101.1.55738 WP_002909101.1.55741 WP_002909101.1.5576 WP_002909101.1.55801 WP_002909101.1.55863 WP_002909101.1.55866 WP_002909101.1.56017 WP_002909101.1.56117 WP_002909101.1.56125 WP_002909101.1.56195 WP_002909101.1.5622 WP_002909101.1.5634 WP_002909101.1.56484 WP_002909101.1.56551 WP_002909101.1.56599 WP_002909101.1.56604 WP_002909101.1.56728 WP_002909101.1.5682 WP_002909101.1.56847 WP_002909101.1.56897 WP_002909101.1.57112 WP_002909101.1.57139 WP_002909101.1.57200 WP_002909101.1.57310 WP_002909101.1.57365 WP_002909101.1.57398 WP_002909101.1.57421 WP_002909101.1.57435 WP_002909101.1.57455 WP_002909101.1.57497 WP_002909101.1.57618 WP_002909101.1.57643 WP_002909101.1.57702 WP_002909101.1.57747 WP_002909101.1.57886 WP_002909101.1.57914 WP_002909101.1.57940 WP_002909101.1.57993 WP_002909101.1.58091 WP_002909101.1.58118 WP_002909101.1.58176 WP_002909101.1.58224 WP_002909101.1.58230 WP_002909101.1.58280 WP_002909101.1.58300 WP_002909101.1.58307 WP_002909101.1.5831 WP_002909101.1.58466 WP_002909101.1.58594 WP_002909101.1.58685 WP_002909101.1.58752 WP_002909101.1.58771 WP_002909101.1.58873 WP_002909101.1.58890 WP_002909101.1.58945 WP_002909101.1.58980 WP_002909101.1.58985 WP_002909101.1.59015 WP_002909101.1.59042 WP_002909101.1.59074 WP_002909101.1.59115 WP_002909101.1.59172 WP_002909101.1.59222 WP_002909101.1.59485 WP_002909101.1.5951 WP_002909101.1.59518 WP_002909101.1.59559 WP_002909101.1.59600 WP_002909101.1.59620 WP_002909101.1.59705 WP_002909101.1.59708 WP_002909101.1.59743 WP_002909101.1.5975 WP_002909101.1.59840 WP_002909101.1.59873 WP_002909101.1.59924 WP_002909101.1.59972 WP_002909101.1.59993 WP_002909101.1.59996 WP_002909101.1.60038 WP_002909101.1.60060 WP_002909101.1.60266 WP_002909101.1.60283 WP_002909101.1.60336 WP_002909101.1.60372 WP_002909101.1.60511 WP_002909101.1.60534 WP_002909101.1.60564 WP_002909101.1.60587 WP_002909101.1.60611 WP_002909101.1.60745 WP_002909101.1.60774 WP_002909101.1.60830 WP_002909101.1.60843 WP_002909101.1.60861 WP_002909101.1.6089 WP_002909101.1.60905 WP_002909101.1.60922 WP_002909101.1.6099 WP_002909101.1.60995 WP_002909101.1.61079 WP_002909101.1.6122 WP_002909101.1.61416 WP_002909101.1.61556 WP_002909101.1.61572 WP_002909101.1.61640 WP_002909101.1.6180 WP_002909101.1.61812 WP_002909101.1.61940 WP_002909101.1.61973 WP_002909101.1.61994 WP_002909101.1.62050 WP_002909101.1.62082 WP_002909101.1.62111 WP_002909101.1.62188 WP_002909101.1.62226 WP_002909101.1.62292 WP_002909101.1.62294 WP_002909101.1.62400 WP_002909101.1.62452 WP_002909101.1.62473 WP_002909101.1.62501 WP_002909101.1.62502 WP_002909101.1.62560 WP_002909101.1.62579 WP_002909101.1.62603 WP_002909101.1.6265 WP_002909101.1.62719 WP_002909101.1.62733 WP_002909101.1.62734 WP_002909101.1.62760 WP_002909101.1.62783 WP_002909101.1.63098 WP_002909101.1.63123 WP_002909101.1.6315 WP_002909101.1.63164 WP_002909101.1.63309 WP_002909101.1.63351 WP_002909101.1.6347 WP_002909101.1.63485 WP_002909101.1.63582 WP_002909101.1.63610 WP_002909101.1.63643 WP_002909101.1.63671 WP_002909101.1.63750 WP_002909101.1.6379 WP_002909101.1.63802 WP_002909101.1.6391 WP_002909101.1.63956 WP_002909101.1.63968 WP_002909101.1.63972 WP_002909101.1.64001 WP_002909101.1.6401 WP_002909101.1.64075 WP_002909101.1.64099 WP_002909101.1.64114 WP_002909101.1.64140 WP_002909101.1.64143 WP_002909101.1.64187 WP_002909101.1.64191 WP_002909101.1.64211 WP_002909101.1.64348 WP_002909101.1.6442 WP_002909101.1.64427 WP_002909101.1.64484 WP_002909101.1.64593 WP_002909101.1.64735 WP_002909101.1.64841 WP_002909101.1.64852 WP_002909101.1.64865 WP_002909101.1.64914 WP_002909101.1.64945 WP_002909101.1.65021 WP_002909101.1.65077 WP_002909101.1.65108 WP_002909101.1.65166 WP_002909101.1.65215 WP_002909101.1.6524 WP_002909101.1.65398 WP_002909101.1.65421 WP_002909101.1.65436 WP_002909101.1.65472 WP_002909101.1.65530 WP_002909101.1.65552 WP_002909101.1.65564 WP_002909101.1.65603 WP_002909101.1.65611 WP_002909101.1.65813 WP_002909101.1.65845 WP_002909101.1.660 WP_002909101.1.66019 WP_002909101.1.66047 WP_002909101.1.66070 WP_002909101.1.6610 WP_002909101.1.66108 WP_002909101.1.66117 WP_002909101.1.66152 WP_002909101.1.66271 WP_002909101.1.66292 WP_002909101.1.66339 WP_002909101.1.66409 WP_002909101.1.66430 WP_002909101.1.6644 WP_002909101.1.66547 WP_002909101.1.66555 WP_002909101.1.66577 WP_002909101.1.66597 WP_002909101.1.6670 WP_002909101.1.66709 WP_002909101.1.66740 WP_002909101.1.6678 WP_002909101.1.66839 WP_002909101.1.66857 WP_002909101.1.66896 WP_002909101.1.66930 WP_002909101.1.66947 WP_002909101.1.6715 WP_002909101.1.67313 WP_002909101.1.6737 WP_002909101.1.67492 WP_002909101.1.67512 WP_002909101.1.6754 WP_002909101.1.67766 WP_002909101.1.6779 WP_002909101.1.67855 WP_002909101.1.67916 WP_002909101.1.67929 WP_002909101.1.67936 WP_002909101.1.67946 WP_002909101.1.68090 WP_002909101.1.68173 WP_002909101.1.68189 WP_002909101.1.6823 WP_002909101.1.68403 WP_002909101.1.68507 WP_002909101.1.68519 WP_002909101.1.68659 WP_002909101.1.6868 WP_002909101.1.68768 WP_002909101.1.68844 WP_002909101.1.68848 WP_002909101.1.68891 WP_002909101.1.68940 WP_002909101.1.68946 WP_002909101.1.68969 WP_002909101.1.69027 WP_002909101.1.69028 WP_002909101.1.69055 WP_002909101.1.69062 WP_002909101.1.6912 WP_002909101.1.69153 WP_002909101.1.69212 WP_002909101.1.69268 WP_002909101.1.69384 WP_002909101.1.69453 WP_002909101.1.69459 WP_002909101.1.69576 WP_002909101.1.69595 WP_002909101.1.69637 WP_002909101.1.69691 WP_002909101.1.69719 WP_002909101.1.69738 WP_002909101.1.69744 WP_002909101.1.69753 WP_002909101.1.69755 WP_002909101.1.69814 WP_002909101.1.69836 WP_002909101.1.69915 WP_002909101.1.70009 WP_002909101.1.70101 WP_002909101.1.70112 WP_002909101.1.702 WP_002909101.1.70519 WP_002909101.1.70550 WP_002909101.1.70681 WP_002909101.1.70718 WP_002909101.1.70847 WP_002909101.1.70859 WP_002909101.1.7087 WP_002909101.1.70870 WP_002909101.1.70873 WP_002909101.1.70966 WP_002909101.1.71056 WP_002909101.1.71212 WP_002909101.1.71241 WP_002909101.1.71286 WP_002909101.1.71291 WP_002909101.1.71296 WP_002909101.1.7136 WP_002909101.1.71387 WP_002909101.1.71393 WP_002909101.1.71504 WP_002909101.1.71611 WP_002909101.1.71625 WP_002909101.1.71634 WP_002909101.1.7168 WP_002909101.1.7181 WP_002909101.1.71913 WP_002909101.1.71990 WP_002909101.1.72139 WP_002909101.1.72154 WP_002909101.1.72201 WP_002909101.1.72214 WP_002909101.1.72274 WP_002909101.1.72341 WP_002909101.1.72597 WP_002909101.1.72632 WP_002909101.1.72673 WP_002909101.1.72688 WP_002909101.1.7273 WP_002909101.1.72746 WP_002909101.1.72763 WP_002909101.1.73038 WP_002909101.1.73208 WP_002909101.1.73236 WP_002909101.1.73301 WP_002909101.1.73316 WP_002909101.1.73319 WP_002909101.1.73332 WP_002909101.1.73472 WP_002909101.1.73558 WP_002909101.1.73562 WP_002909101.1.73589 WP_002909101.1.73635 WP_002909101.1.73732 WP_002909101.1.73742 WP_002909101.1.73770 WP_002909101.1.73887 WP_002909101.1.73904 WP_002909101.1.74001 WP_002909101.1.74048 WP_002909101.1.74176 WP_002909101.1.74256 WP_002909101.1.74332 WP_002909101.1.74394 WP_002909101.1.74447 WP_002909101.1.74490 WP_002909101.1.7455 WP_002909101.1.74692 WP_002909101.1.747 WP_002909101.1.74759 WP_002909101.1.74788 WP_002909101.1.74817 WP_002909101.1.74839 WP_002909101.1.74847 WP_002909101.1.74905 WP_002909101.1.74909 WP_002909101.1.7493 WP_002909101.1.74981 WP_002909101.1.750 WP_002909101.1.75005 WP_002909101.1.75013 WP_002909101.1.75014 WP_002909101.1.75035 WP_002909101.1.7510 WP_002909101.1.75115 WP_002909101.1.75152 WP_002909101.1.75366 WP_002909101.1.75396 WP_002909101.1.75457 WP_002909101.1.75561 WP_002909101.1.75572 WP_002909101.1.75592 WP_002909101.1.75608 WP_002909101.1.75637 WP_002909101.1.75719 WP_002909101.1.7574 WP_002909101.1.75748 WP_002909101.1.7578 WP_002909101.1.75784 WP_002909101.1.75909 WP_002909101.1.75961 WP_002909101.1.76001 WP_002909101.1.76090 WP_002909101.1.76107 WP_002909101.1.7623 WP_002909101.1.76245 WP_002909101.1.76292 WP_002909101.1.7631 WP_002909101.1.76412 WP_002909101.1.7649 WP_002909101.1.76561 WP_002909101.1.76607 WP_002909101.1.76657 WP_002909101.1.76819 WP_002909101.1.76832 WP_002909101.1.76912 WP_002909101.1.77077 WP_002909101.1.77085 WP_002909101.1.77105 WP_002909101.1.77211 WP_002909101.1.7730 WP_002909101.1.77304 WP_002909101.1.77307 WP_002909101.1.77367 WP_002909101.1.77516 WP_002909101.1.77655 WP_002909101.1.77696 WP_002909101.1.777 WP_002909101.1.77723 WP_002909101.1.7773 WP_002909101.1.77799 WP_002909101.1.77800 WP_002909101.1.77802 WP_002909101.1.77831 WP_002909101.1.77875 WP_002909101.1.78001 WP_002909101.1.78012 WP_002909101.1.78062 WP_002909101.1.78065 WP_002909101.1.78103 WP_002909101.1.7811 WP_002909101.1.78119 WP_002909101.1.78214 WP_002909101.1.78260 WP_002909101.1.78290 WP_002909101.1.78334 WP_002909101.1.78350 WP_002909101.1.78418 WP_002909101.1.78472 WP_002909101.1.78534 WP_002909101.1.7858 WP_002909101.1.78591 WP_002909101.1.78597 WP_002909101.1.78613 WP_002909101.1.78725 WP_002909101.1.78745 WP_002909101.1.78772 WP_002909101.1.78861 WP_002909101.1.78922 WP_002909101.1.78950 WP_002909101.1.78962 WP_002909101.1.78981 WP_002909101.1.79108 WP_002909101.1.79109 WP_002909101.1.79141 WP_002909101.1.79175 WP_002909101.1.79211 WP_002909101.1.79266 WP_002909101.1.7935 WP_002909101.1.79420 WP_002909101.1.79520 WP_002909101.1.79541 WP_002909101.1.79608 WP_002909101.1.79625 WP_002909101.1.79636 WP_002909101.1.79868 WP_002909101.1.79935 WP_002909101.1.8001 WP_002909101.1.80027 WP_002909101.1.80062 WP_002909101.1.80217 WP_002909101.1.80227 WP_002909101.1.80350 WP_002909101.1.80355 WP_002909101.1.80362 WP_002909101.1.80466 WP_002909101.1.8054 WP_002909101.1.80554 WP_002909101.1.8056 WP_002909101.1.807 WP_002909101.1.80704 WP_002909101.1.80767 WP_002909101.1.80771 WP_002909101.1.80816 WP_002909101.1.81139 WP_002909101.1.81144 WP_002909101.1.81159 WP_002909101.1.81191 WP_002909101.1.81212 WP_002909101.1.81235 WP_002909101.1.81282 WP_002909101.1.81285 WP_002909101.1.81431 WP_002909101.1.81449 WP_002909101.1.81452 WP_002909101.1.81488 WP_002909101.1.81544 WP_002909101.1.81633 WP_002909101.1.81659 WP_002909101.1.81675 WP_002909101.1.81683 WP_002909101.1.81744 WP_002909101.1.81759 WP_002909101.1.82003 WP_002909101.1.82034 WP_002909101.1.82129 WP_002909101.1.82170 WP_002909101.1.82299 WP_002909101.1.82367 WP_002909101.1.82370 WP_002909101.1.82446 WP_002909101.1.82452 WP_002909101.1.8252 WP_002909101.1.82704 WP_002909101.1.82795 WP_002909101.1.82939 WP_002909101.1.8296 WP_002909101.1.83014 WP_002909101.1.83022 WP_002909101.1.83076 WP_002909101.1.83117 WP_002909101.1.8320 WP_002909101.1.83263 WP_002909101.1.83285 WP_002909101.1.83300 WP_002909101.1.83337 WP_002909101.1.83379 WP_002909101.1.83556 WP_002909101.1.8356 WP_002909101.1.83691 WP_002909101.1.83746 WP_002909101.1.83872 WP_002909101.1.83948 WP_002909101.1.84066 WP_002909101.1.84128 WP_002909101.1.84224 WP_002909101.1.84226 WP_002909101.1.84309 WP_002909101.1.84315 WP_002909101.1.84417 WP_002909101.1.8448 WP_002909101.1.84549 WP_002909101.1.84560 WP_002909101.1.8464 WP_002909101.1.84650 WP_002909101.1.84681 WP_002909101.1.84737 WP_002909101.1.84787 WP_002909101.1.84890 WP_002909101.1.84900 WP_002909101.1.85102 WP_002909101.1.85115 WP_002909101.1.85191 WP_002909101.1.85193 WP_002909101.1.85263 WP_002909101.1.85366 WP_002909101.1.85423 WP_002909101.1.8549 WP_002909101.1.85523 WP_002909101.1.85564 WP_002909101.1.85680 WP_002909101.1.85731 WP_002909101.1.85761 WP_002909101.1.85783 WP_002909101.1.85785 WP_002909101.1.85805 WP_002909101.1.85812 WP_002909101.1.85877 WP_002909101.1.85954 WP_002909101.1.85957 WP_002909101.1.85960 WP_002909101.1.85970 WP_002909101.1.85985 WP_002909101.1.86074 WP_002909101.1.86169 WP_002909101.1.86203 WP_002909101.1.86302 WP_002909101.1.86384 WP_002909101.1.86528 WP_002909101.1.86556 WP_002909101.1.86668 WP_002909101.1.8667 WP_002909101.1.8668 WP_002909101.1.86737 WP_002909101.1.86835 WP_002909101.1.86946 WP_002909101.1.87112 WP_002909101.1.87113 WP_002909101.1.87130 WP_002909101.1.87132 WP_002909101.1.87140 WP_002909101.1.87202 WP_002909101.1.87212 WP_002909101.1.87235 WP_002909101.1.87313 WP_002909101.1.87354 WP_002909101.1.87437 WP_002909101.1.87441 WP_002909101.1.87591 WP_002909101.1.8763 WP_002909101.1.87631 WP_002909101.1.87645 WP_002909101.1.87702 WP_002909101.1.8775 WP_002909101.1.87767 WP_002909101.1.87793 WP_002909101.1.87907 WP_002909101.1.87962 WP_002909101.1.88041 WP_002909101.1.88298 WP_002909101.1.8832 WP_002909101.1.88394 WP_002909101.1.88398 WP_002909101.1.88419 WP_002909101.1.8851 WP_002909101.1.8853 WP_002909101.1.88551 WP_002909101.1.88568 WP_002909101.1.88574 WP_002909101.1.88645 WP_002909101.1.88655 WP_002909101.1.88702 WP_002909101.1.88823 WP_002909101.1.88870 WP_002909101.1.88885 WP_002909101.1.8896 WP_002909101.1.8905 WP_002909101.1.89072 WP_002909101.1.89110 WP_002909101.1.89118 WP_002909101.1.892 WP_002909101.1.89259 WP_002909101.1.89315 WP_002909101.1.89318 WP_002909101.1.89326 WP_002909101.1.89327 WP_002909101.1.89467 WP_002909101.1.89558 WP_002909101.1.89618 WP_002909101.1.89688 WP_002909101.1.89692 WP_002909101.1.89722 WP_002909101.1.8983 WP_002909101.1.89958 WP_002909101.1.90020 WP_002909101.1.90051 WP_002909101.1.901 WP_002909101.1.90142 WP_002909101.1.9025 WP_002909101.1.90374 WP_002909101.1.90383 WP_002909101.1.90446 WP_002909101.1.90515 WP_002909101.1.90581 WP_002909101.1.90621 WP_002909101.1.90662 WP_002909101.1.90699 WP_002909101.1.90802 WP_002909101.1.90870 WP_002909101.1.90879 WP_002909101.1.90904 WP_002909101.1.9092 WP_002909101.1.90947 WP_002909101.1.90993 WP_002909101.1.91001 WP_002909101.1.91033 WP_002909101.1.9111 WP_002909101.1.91134 WP_002909101.1.91181 WP_002909101.1.91187 WP_002909101.1.91298 WP_002909101.1.91319 WP_002909101.1.91327 WP_002909101.1.91385 WP_002909101.1.91402 WP_002909101.1.91415 WP_002909101.1.91435 WP_002909101.1.91484 WP_002909101.1.91534 WP_002909101.1.91544 WP_002909101.1.91550 WP_002909101.1.91678 WP_002909101.1.91684 WP_002909101.1.9170 WP_002909101.1.91725 WP_002909101.1.91738 WP_002909101.1.91741 WP_002909101.1.91751 WP_002909101.1.918 WP_002909101.1.91842 WP_002909101.1.91847 WP_002909101.1.91900 WP_002909101.1.91981 WP_002909101.1.92020 WP_002909101.1.92066 WP_002909101.1.92084 WP_002909101.1.92117 WP_002909101.1.92189 WP_002909101.1.92209 WP_002909101.1.92246 WP_002909101.1.92393 WP_002909101.1.92460 WP_002909101.1.925 WP_002909101.1.92569 WP_002909101.1.9258 WP_002909101.1.9259 WP_002909101.1.92601 WP_002909101.1.92608 WP_002909101.1.92704 WP_002909101.1.92771 WP_002909101.1.92782 WP_002909101.1.92873 WP_002909101.1.92984 WP_002909101.1.9300 WP_002909101.1.93004 WP_002909101.1.93058 WP_002909101.1.93070 WP_002909101.1.93081 WP_002909101.1.93131 WP_002909101.1.93132 WP_002909101.1.93161 WP_002909101.1.93226 WP_002909101.1.93246 WP_002909101.1.93256 WP_002909101.1.93278 WP_002909101.1.93308 WP_002909101.1.93445 WP_002909101.1.9353 WP_002909101.1.9383 WP_002909101.1.94021 WP_002909101.1.94163 WP_002909101.1.94200 WP_002909101.1.94216 WP_002909101.1.94290 WP_002909101.1.94493 WP_002909101.1.94518 WP_002909101.1.94599 WP_002909101.1.94605 WP_002909101.1.94608 WP_002909101.1.94642 WP_002909101.1.94701 WP_002909101.1.94777 WP_002909101.1.94860 WP_002909101.1.94871 WP_002909101.1.94894 WP_002909101.1.94909 WP_002909101.1.94956 WP_002909101.1.95021 WP_002909101.1.95030 WP_002909101.1.95122 WP_002909101.1.9521 WP_002909101.1.95299 WP_002909101.1.95405 WP_002909101.1.95408 WP_002909101.1.95429 WP_002909101.1.95486 WP_002909101.1.95524 WP_002909101.1.95562 WP_002909101.1.95593 WP_002909101.1.95710 WP_002909101.1.95723 WP_002909101.1.95843 WP_002909101.1.95889 WP_002909101.1.95898 WP_002909101.1.96131 WP_002909101.1.96202 WP_002909101.1.9626 WP_002909101.1.96375 WP_002909101.1.96383 WP_002909101.1.96405 WP_002909101.1.9651 WP_002909101.1.96645 WP_002909101.1.96653 WP_002909101.1.96684 WP_002909101.1.96793 WP_002909101.1.96979 WP_002909101.1.96991 WP_002909101.1.97037 WP_002909101.1.97092 WP_002909101.1.97114 WP_002909101.1.97186 WP_002909101.1.97197 WP_002909101.1.97236 WP_002909101.1.97263 WP_002909101.1.97273 WP_002909101.1.97294 WP_002909101.1.97333 WP_002909101.1.97353 WP_002909101.1.97416 WP_002909101.1.97419 WP_002909101.1.97475 WP_002909101.1.97567 WP_002909101.1.97680 WP_002909101.1.97728 WP_002909101.1.97794 WP_002909101.1.97833 WP_002909101.1.9800 WP_002909101.1.98016 WP_002909101.1.98184 WP_002909101.1.98278 WP_002909101.1.9831 WP_002909101.1.98320 WP_002909101.1.98336 WP_002909101.1.98342 WP_002909101.1.98408 WP_002909101.1.98553 WP_002909101.1.98673 WP_002909101.1.9875 WP_002909101.1.98774 WP_002909101.1.98794 WP_002909101.1.98932 WP_002909101.1.98973 WP_002909101.1.99013 WP_002909101.1.99016 WP_002909101.1.99166 WP_002909101.1.99248 WP_002909101.1.99279 WP_002909101.1.99305 WP_002909101.1.9934 WP_002909101.1.99439 WP_002909101.1.99691 WP_002909101.1.99705 WP_002909101.1.99706 WP_002909101.1.99794 WP_002909101.1.99885 WP_002909101.1.99944 YP_005227468.1.24690 gi|530629837|ref|YP_008425105.1| gi|378979327|ref|YP_005227468.1| 484021.KP1_3279 gi|238895230|ref|YP_002919965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]